Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JA73

Protein Details
Accession A0A015JA73    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-83WKATSFKKPGNKKVKSNNKKAKPRRNPTRACRKNHydrophilic
NLS Segment(s)
PositionSequence
56-82KKPGNKKVKSNNKKAKPRRNPTRACRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRSLESVVVIEKIKALEERLDDIDNRLDTLFSSFYCSSESSSSESDYEPWKATSFKKPGNKKVKSNNKKAKPRRNPTRACRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.16
5 0.19
6 0.2
7 0.21
8 0.2
9 0.21
10 0.23
11 0.2
12 0.19
13 0.15
14 0.13
15 0.11
16 0.13
17 0.12
18 0.08
19 0.14
20 0.13
21 0.13
22 0.15
23 0.15
24 0.15
25 0.15
26 0.16
27 0.13
28 0.13
29 0.14
30 0.13
31 0.13
32 0.13
33 0.14
34 0.14
35 0.13
36 0.13
37 0.13
38 0.15
39 0.18
40 0.26
41 0.31
42 0.37
43 0.45
44 0.53
45 0.63
46 0.71
47 0.75
48 0.75
49 0.79
50 0.83
51 0.84
52 0.86
53 0.87
54 0.87
55 0.9
56 0.92
57 0.93
58 0.93
59 0.94
60 0.94
61 0.94
62 0.94
63 0.93