Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015N9T8

Protein Details
Accession A0A015N9T8    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
11-30RAEKREKKRDVVKVDNKKIEBasic
NLS Segment(s)
PositionSequence
15-18REKK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MESKKFQGEYRAEKREKKRDVVKVDNKKIEEERKNDRVTGPLLDTPPQRVFSELGGISMYQSTKKTNEGYTESWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.76
4 0.74
5 0.74
6 0.73
7 0.77
8 0.79
9 0.79
10 0.8
11 0.82
12 0.79
13 0.7
14 0.65
15 0.61
16 0.59
17 0.56
18 0.5
19 0.5
20 0.51
21 0.51
22 0.49
23 0.44
24 0.36
25 0.31
26 0.27
27 0.21
28 0.17
29 0.16
30 0.18
31 0.18
32 0.2
33 0.21
34 0.22
35 0.2
36 0.19
37 0.19
38 0.17
39 0.22
40 0.17
41 0.16
42 0.14
43 0.13
44 0.12
45 0.13
46 0.13
47 0.1
48 0.11
49 0.14
50 0.16
51 0.2
52 0.24
53 0.26
54 0.32
55 0.35