Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JME7

Protein Details
Accession A0A015JME7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
441-465RENSNSRSRSRSNSRSRNNNSSSSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd00590  RRM_SF  
Amino Acid Sequences MTTPPAPSVINPDILSPPRPVVSTPSGDRPLSPTSTAGAPNKRTRTISDDAMNVDITSPSAPAPNLISTVPSGLPVNKVHVITSPQNITTPVETVDASIHAPSNTSGKGKAVAFDIPERRPSPDGNAAAIKSAPSRYHAAAYLRDAPDAFKAKFTTNRSMCDEVDCSLSRYSSYGARARCDGSGDNKKILVFFNNHDDFTDCVNSPRADLLDLAFSHYSLADAKLSDEMKSLFVTDIPLFLTETQVRQAFSRYGTVIKCKLTPRKHYHNGHIQFSSADAVTQFNDIWTIIYLGNSLCVCPASFSKSQRDSCREHVAILAGIPKNIKEADLLEIATQVNAKALNVPLSISSYKPKPYVYLNFSSFESLEAAKEMTVAFRGKGLTWHPPNEAQTLCHVCGRPGCSSSVCNPRTTQKVDDCLNKLYSRFNAGPRRGRQDSRQSRENSNSRSRSRSNSRSRNNNSSSSRSDQCWHWTHSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.29
4 0.29
5 0.26
6 0.27
7 0.25
8 0.27
9 0.3
10 0.34
11 0.36
12 0.41
13 0.45
14 0.44
15 0.44
16 0.41
17 0.4
18 0.37
19 0.34
20 0.27
21 0.24
22 0.28
23 0.32
24 0.35
25 0.38
26 0.42
27 0.5
28 0.55
29 0.57
30 0.56
31 0.54
32 0.54
33 0.51
34 0.5
35 0.45
36 0.42
37 0.39
38 0.38
39 0.34
40 0.27
41 0.23
42 0.16
43 0.12
44 0.1
45 0.09
46 0.08
47 0.1
48 0.1
49 0.1
50 0.13
51 0.13
52 0.14
53 0.14
54 0.15
55 0.13
56 0.16
57 0.14
58 0.13
59 0.13
60 0.13
61 0.17
62 0.17
63 0.21
64 0.23
65 0.23
66 0.22
67 0.24
68 0.28
69 0.28
70 0.32
71 0.3
72 0.27
73 0.28
74 0.28
75 0.27
76 0.23
77 0.2
78 0.16
79 0.15
80 0.14
81 0.14
82 0.13
83 0.12
84 0.11
85 0.11
86 0.11
87 0.09
88 0.1
89 0.1
90 0.13
91 0.14
92 0.15
93 0.15
94 0.15
95 0.19
96 0.19
97 0.2
98 0.18
99 0.18
100 0.19
101 0.25
102 0.29
103 0.27
104 0.32
105 0.32
106 0.33
107 0.33
108 0.33
109 0.32
110 0.35
111 0.35
112 0.32
113 0.34
114 0.3
115 0.29
116 0.28
117 0.22
118 0.15
119 0.16
120 0.14
121 0.15
122 0.18
123 0.18
124 0.2
125 0.23
126 0.24
127 0.24
128 0.27
129 0.32
130 0.29
131 0.28
132 0.26
133 0.23
134 0.26
135 0.28
136 0.25
137 0.2
138 0.21
139 0.24
140 0.31
141 0.35
142 0.4
143 0.38
144 0.42
145 0.44
146 0.46
147 0.43
148 0.39
149 0.35
150 0.26
151 0.27
152 0.23
153 0.2
154 0.17
155 0.16
156 0.14
157 0.13
158 0.14
159 0.13
160 0.17
161 0.2
162 0.21
163 0.23
164 0.24
165 0.25
166 0.24
167 0.23
168 0.2
169 0.24
170 0.32
171 0.32
172 0.32
173 0.31
174 0.31
175 0.3
176 0.29
177 0.24
178 0.17
179 0.17
180 0.24
181 0.24
182 0.24
183 0.24
184 0.24
185 0.21
186 0.21
187 0.22
188 0.13
189 0.13
190 0.16
191 0.16
192 0.15
193 0.15
194 0.12
195 0.1
196 0.1
197 0.1
198 0.1
199 0.09
200 0.11
201 0.1
202 0.1
203 0.09
204 0.09
205 0.09
206 0.06
207 0.07
208 0.06
209 0.06
210 0.06
211 0.09
212 0.1
213 0.1
214 0.1
215 0.1
216 0.1
217 0.1
218 0.1
219 0.07
220 0.07
221 0.09
222 0.08
223 0.07
224 0.07
225 0.07
226 0.07
227 0.07
228 0.09
229 0.08
230 0.08
231 0.1
232 0.11
233 0.11
234 0.11
235 0.13
236 0.12
237 0.12
238 0.14
239 0.12
240 0.15
241 0.15
242 0.19
243 0.2
244 0.2
245 0.23
246 0.27
247 0.36
248 0.39
249 0.49
250 0.53
251 0.6
252 0.69
253 0.7
254 0.71
255 0.73
256 0.7
257 0.64
258 0.56
259 0.46
260 0.36
261 0.32
262 0.25
263 0.15
264 0.1
265 0.07
266 0.07
267 0.07
268 0.08
269 0.07
270 0.06
271 0.06
272 0.06
273 0.06
274 0.06
275 0.07
276 0.06
277 0.06
278 0.07
279 0.06
280 0.08
281 0.08
282 0.08
283 0.06
284 0.06
285 0.06
286 0.07
287 0.09
288 0.12
289 0.17
290 0.21
291 0.29
292 0.36
293 0.42
294 0.48
295 0.52
296 0.52
297 0.53
298 0.59
299 0.51
300 0.44
301 0.39
302 0.33
303 0.27
304 0.23
305 0.23
306 0.14
307 0.14
308 0.14
309 0.13
310 0.14
311 0.13
312 0.13
313 0.08
314 0.09
315 0.12
316 0.13
317 0.13
318 0.11
319 0.12
320 0.12
321 0.11
322 0.1
323 0.07
324 0.07
325 0.07
326 0.07
327 0.08
328 0.09
329 0.11
330 0.11
331 0.11
332 0.11
333 0.14
334 0.15
335 0.14
336 0.18
337 0.19
338 0.23
339 0.25
340 0.25
341 0.24
342 0.3
343 0.37
344 0.39
345 0.43
346 0.42
347 0.42
348 0.42
349 0.41
350 0.33
351 0.26
352 0.21
353 0.14
354 0.12
355 0.11
356 0.11
357 0.09
358 0.09
359 0.08
360 0.07
361 0.1
362 0.1
363 0.1
364 0.11
365 0.12
366 0.12
367 0.16
368 0.19
369 0.26
370 0.31
371 0.34
372 0.36
373 0.4
374 0.42
375 0.42
376 0.4
377 0.31
378 0.33
379 0.34
380 0.32
381 0.32
382 0.3
383 0.27
384 0.31
385 0.34
386 0.3
387 0.27
388 0.28
389 0.26
390 0.29
391 0.35
392 0.4
393 0.38
394 0.37
395 0.39
396 0.43
397 0.48
398 0.49
399 0.49
400 0.46
401 0.52
402 0.55
403 0.6
404 0.57
405 0.54
406 0.54
407 0.48
408 0.43
409 0.41
410 0.38
411 0.37
412 0.37
413 0.42
414 0.47
415 0.54
416 0.62
417 0.64
418 0.7
419 0.69
420 0.71
421 0.71
422 0.72
423 0.75
424 0.74
425 0.75
426 0.71
427 0.72
428 0.77
429 0.77
430 0.74
431 0.73
432 0.74
433 0.71
434 0.74
435 0.71
436 0.71
437 0.73
438 0.75
439 0.76
440 0.78
441 0.82
442 0.85
443 0.89
444 0.89
445 0.84
446 0.83
447 0.79
448 0.75
449 0.72
450 0.68
451 0.63
452 0.56
453 0.54
454 0.5
455 0.52
456 0.51