Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015J796

Protein Details
Accession A0A015J796    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-109MEEEKEKVRKKKDLDQRKKSVBasic
NLS Segment(s)
PositionSequence
94-107EKVRKKKDLDQRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSGINPSIDNVSSFNNTSAPDMPVGPNGGDKYENSRHLNYGQTDQKKPNNESRRSVRRYSASSDTKPVLVHTFQEEILGGLTGDDLIKMEEEKEKVRKKKDLDQRKKSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.18
4 0.2
5 0.2
6 0.18
7 0.16
8 0.16
9 0.16
10 0.16
11 0.17
12 0.14
13 0.15
14 0.14
15 0.14
16 0.14
17 0.13
18 0.19
19 0.24
20 0.3
21 0.31
22 0.32
23 0.33
24 0.34
25 0.37
26 0.32
27 0.33
28 0.34
29 0.36
30 0.38
31 0.42
32 0.45
33 0.47
34 0.48
35 0.52
36 0.54
37 0.53
38 0.56
39 0.6
40 0.65
41 0.64
42 0.63
43 0.57
44 0.52
45 0.5
46 0.48
47 0.48
48 0.43
49 0.4
50 0.41
51 0.37
52 0.34
53 0.31
54 0.27
55 0.21
56 0.16
57 0.16
58 0.15
59 0.15
60 0.14
61 0.15
62 0.13
63 0.1
64 0.1
65 0.09
66 0.06
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.07
77 0.11
78 0.14
79 0.2
80 0.29
81 0.39
82 0.47
83 0.54
84 0.61
85 0.64
86 0.71
87 0.76
88 0.78
89 0.8