Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JQC4

Protein Details
Accession A0A015JQC4   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-27IEDSPIKKKNRGSRPPNSIWKDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007021  DUF659  
Pfam View protein in Pfam  
PF04937  DUF659  
Amino Acid Sequences MTDHIEDSPIKKKNRGSRPPNSIWKDINKGEAVGSGKFAASCKYCKNTWSRGEVSKLEEHLSNYCPDAPAAVVRKYMTKVMERQDKSKSSKKRKYSEGQKLNVGYNTPTREVLVNQLLERELAQVNFKVNSELEKETNLTLVFDGWTSGTHRSIWNFIVMTPSHKEYLYQLSDLSENSHTAEYLVTDLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.72
3 0.73
4 0.76
5 0.82
6 0.85
7 0.87
8 0.83
9 0.78
10 0.73
11 0.7
12 0.67
13 0.59
14 0.55
15 0.45
16 0.4
17 0.34
18 0.32
19 0.27
20 0.2
21 0.2
22 0.15
23 0.14
24 0.14
25 0.14
26 0.14
27 0.14
28 0.18
29 0.22
30 0.26
31 0.27
32 0.31
33 0.37
34 0.42
35 0.46
36 0.49
37 0.48
38 0.48
39 0.52
40 0.49
41 0.47
42 0.42
43 0.37
44 0.31
45 0.28
46 0.25
47 0.23
48 0.22
49 0.18
50 0.16
51 0.15
52 0.14
53 0.12
54 0.11
55 0.09
56 0.12
57 0.14
58 0.14
59 0.15
60 0.15
61 0.17
62 0.18
63 0.2
64 0.18
65 0.18
66 0.22
67 0.28
68 0.37
69 0.37
70 0.39
71 0.42
72 0.46
73 0.49
74 0.53
75 0.56
76 0.57
77 0.64
78 0.7
79 0.71
80 0.73
81 0.76
82 0.79
83 0.79
84 0.77
85 0.71
86 0.66
87 0.61
88 0.54
89 0.45
90 0.35
91 0.25
92 0.21
93 0.2
94 0.17
95 0.16
96 0.15
97 0.15
98 0.15
99 0.18
100 0.17
101 0.16
102 0.15
103 0.15
104 0.15
105 0.14
106 0.14
107 0.11
108 0.09
109 0.08
110 0.1
111 0.1
112 0.12
113 0.12
114 0.12
115 0.12
116 0.11
117 0.13
118 0.15
119 0.17
120 0.16
121 0.17
122 0.18
123 0.16
124 0.18
125 0.16
126 0.12
127 0.1
128 0.09
129 0.08
130 0.07
131 0.07
132 0.06
133 0.07
134 0.09
135 0.11
136 0.12
137 0.13
138 0.16
139 0.17
140 0.2
141 0.2
142 0.21
143 0.19
144 0.18
145 0.22
146 0.2
147 0.22
148 0.23
149 0.25
150 0.23
151 0.22
152 0.23
153 0.22
154 0.3
155 0.29
156 0.25
157 0.23
158 0.23
159 0.24
160 0.24
161 0.24
162 0.17
163 0.15
164 0.16
165 0.16
166 0.14
167 0.13
168 0.14
169 0.11