Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015I9A9

Protein Details
Accession A0A015I9A9    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-29IRKIDLCNDNKRTRNKKNSLVCPSCIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MSYIRKIDLCNDNKRTRNKKNSLVCPSCIETNDYFNLFSKKINQIEEIVDKLRKNSNLPSKKADQFSIFNAKFTLNNVPCELEYNLSKFSLEDLQKLVIVTTPNCNNKYPSSNTSNESDSSEYSNNESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.8
4 0.83
5 0.82
6 0.83
7 0.85
8 0.87
9 0.87
10 0.82
11 0.74
12 0.67
13 0.62
14 0.54
15 0.45
16 0.38
17 0.29
18 0.28
19 0.27
20 0.23
21 0.21
22 0.2
23 0.22
24 0.19
25 0.19
26 0.21
27 0.25
28 0.28
29 0.29
30 0.28
31 0.27
32 0.29
33 0.3
34 0.27
35 0.22
36 0.21
37 0.2
38 0.21
39 0.23
40 0.22
41 0.22
42 0.28
43 0.36
44 0.41
45 0.44
46 0.47
47 0.48
48 0.51
49 0.51
50 0.45
51 0.37
52 0.31
53 0.32
54 0.37
55 0.31
56 0.26
57 0.25
58 0.24
59 0.21
60 0.21
61 0.27
62 0.18
63 0.2
64 0.21
65 0.21
66 0.21
67 0.23
68 0.22
69 0.15
70 0.15
71 0.15
72 0.16
73 0.15
74 0.15
75 0.11
76 0.13
77 0.18
78 0.17
79 0.17
80 0.17
81 0.18
82 0.19
83 0.19
84 0.17
85 0.12
86 0.13
87 0.13
88 0.18
89 0.24
90 0.3
91 0.32
92 0.34
93 0.35
94 0.38
95 0.44
96 0.44
97 0.43
98 0.44
99 0.45
100 0.46
101 0.47
102 0.44
103 0.39
104 0.36
105 0.31
106 0.26
107 0.27
108 0.27
109 0.24