Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KY24

Protein Details
Accession A0A015KY24    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MENSKKRLQKRKSNTTKKTNRMTKKQKTTISNHydrophilic
NLS Segment(s)
PositionSequence
5-21KKRLQKRKSNTTKKTNR
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MENSKKRLQKRKSNTTKKTNRMTKKQKTTISNIDNSYDSRNALEESNLPNGQQQKIILEFEKERNKILKERLSLKKELLELGEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.93
4 0.9
5 0.9
6 0.89
7 0.88
8 0.87
9 0.89
10 0.88
11 0.88
12 0.88
13 0.85
14 0.8
15 0.77
16 0.76
17 0.7
18 0.64
19 0.54
20 0.48
21 0.41
22 0.37
23 0.32
24 0.23
25 0.18
26 0.13
27 0.13
28 0.12
29 0.11
30 0.11
31 0.1
32 0.11
33 0.15
34 0.15
35 0.15
36 0.16
37 0.19
38 0.19
39 0.18
40 0.16
41 0.14
42 0.16
43 0.18
44 0.16
45 0.17
46 0.19
47 0.25
48 0.33
49 0.32
50 0.34
51 0.37
52 0.4
53 0.43
54 0.49
55 0.48
56 0.47
57 0.55
58 0.62
59 0.63
60 0.62
61 0.58
62 0.55
63 0.49
64 0.45