Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JHJ0

Protein Details
Accession A0A015JHJ0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-44LEIARRKDAKSVRIKKKKKKNGPSKVKFKLRCSBasic
NLS Segment(s)
PositionSequence
16-40RRKDAKSVRIKKKKKKNGPSKVKFK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKQIDDIKYFLEIARRKDAKSVRIKKKKKKNGPSKVKFKLRCSKYLYTFVIEDAEKAEKLQKSLPPGLTVTDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.38
4 0.37
5 0.44
6 0.48
7 0.49
8 0.56
9 0.62
10 0.63
11 0.72
12 0.81
13 0.84
14 0.9
15 0.91
16 0.91
17 0.91
18 0.91
19 0.92
20 0.93
21 0.93
22 0.92
23 0.9
24 0.88
25 0.83
26 0.79
27 0.78
28 0.71
29 0.69
30 0.66
31 0.63
32 0.59
33 0.61
34 0.54
35 0.47
36 0.43
37 0.36
38 0.32
39 0.25
40 0.2
41 0.14
42 0.15
43 0.12
44 0.12
45 0.18
46 0.17
47 0.19
48 0.24
49 0.25
50 0.31
51 0.38
52 0.39
53 0.36
54 0.35