Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JE11

Protein Details
Accession A0A015JE11   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
212-234DNTNIPKRYKWSKKRGEYYNTMEHydrophilic
NLS Segment(s)
PositionSequence
245-248KRGP
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MYKVNYFIQGLSPTMISRVMETAPATLDAAIERAKIIETGNQMVLQSVMNQSLLNRNNVQNNNTQDVRQNDNGKNECHRKGHFATRCPLGNNIRRNERRVNLMDTGNYGRDDEYEEYEESDDNYDYEYEEYDDPQLYSYERDLYEKDNPVQERRRSNRINPAQGWKNFGKPNLDKDIVERGKEDYKYRNREETPMEEKEDEQPMYDRPIGPDNTNIPKRYKWSKKRGEYYNTMEGINRWKEAGGKRGPRKDNIVGVKSKDPVDYGNLLNIVEQQGKMIKRML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.14
4 0.13
5 0.14
6 0.13
7 0.14
8 0.15
9 0.14
10 0.14
11 0.14
12 0.13
13 0.11
14 0.11
15 0.09
16 0.1
17 0.1
18 0.09
19 0.08
20 0.08
21 0.08
22 0.09
23 0.1
24 0.13
25 0.15
26 0.18
27 0.19
28 0.19
29 0.19
30 0.18
31 0.18
32 0.14
33 0.12
34 0.1
35 0.1
36 0.1
37 0.1
38 0.11
39 0.18
40 0.2
41 0.23
42 0.25
43 0.28
44 0.36
45 0.4
46 0.42
47 0.41
48 0.43
49 0.44
50 0.41
51 0.39
52 0.36
53 0.37
54 0.4
55 0.39
56 0.42
57 0.4
58 0.48
59 0.5
60 0.47
61 0.51
62 0.53
63 0.52
64 0.49
65 0.48
66 0.46
67 0.48
68 0.56
69 0.54
70 0.52
71 0.51
72 0.51
73 0.51
74 0.46
75 0.47
76 0.45
77 0.46
78 0.48
79 0.49
80 0.54
81 0.55
82 0.59
83 0.6
84 0.54
85 0.54
86 0.5
87 0.49
88 0.42
89 0.4
90 0.35
91 0.31
92 0.3
93 0.24
94 0.2
95 0.16
96 0.12
97 0.11
98 0.14
99 0.12
100 0.13
101 0.14
102 0.14
103 0.14
104 0.15
105 0.14
106 0.11
107 0.11
108 0.09
109 0.06
110 0.07
111 0.06
112 0.06
113 0.07
114 0.06
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.07
124 0.08
125 0.08
126 0.09
127 0.09
128 0.11
129 0.11
130 0.14
131 0.18
132 0.2
133 0.21
134 0.23
135 0.24
136 0.29
137 0.36
138 0.38
139 0.43
140 0.46
141 0.53
142 0.53
143 0.57
144 0.61
145 0.62
146 0.64
147 0.57
148 0.6
149 0.58
150 0.55
151 0.55
152 0.46
153 0.44
154 0.39
155 0.38
156 0.38
157 0.33
158 0.37
159 0.39
160 0.39
161 0.33
162 0.33
163 0.41
164 0.35
165 0.33
166 0.29
167 0.25
168 0.29
169 0.31
170 0.32
171 0.31
172 0.38
173 0.46
174 0.49
175 0.54
176 0.5
177 0.53
178 0.55
179 0.52
180 0.5
181 0.45
182 0.44
183 0.37
184 0.36
185 0.35
186 0.35
187 0.27
188 0.22
189 0.2
190 0.18
191 0.22
192 0.23
193 0.2
194 0.18
195 0.24
196 0.24
197 0.24
198 0.27
199 0.28
200 0.36
201 0.4
202 0.41
203 0.38
204 0.39
205 0.45
206 0.52
207 0.57
208 0.59
209 0.65
210 0.73
211 0.8
212 0.86
213 0.88
214 0.86
215 0.83
216 0.79
217 0.77
218 0.67
219 0.57
220 0.49
221 0.41
222 0.41
223 0.36
224 0.29
225 0.21
226 0.2
227 0.26
228 0.3
229 0.37
230 0.38
231 0.46
232 0.55
233 0.64
234 0.68
235 0.67
236 0.7
237 0.68
238 0.68
239 0.66
240 0.63
241 0.59
242 0.59
243 0.59
244 0.54
245 0.49
246 0.41
247 0.34
248 0.29
249 0.29
250 0.28
251 0.24
252 0.25
253 0.24
254 0.23
255 0.22
256 0.22
257 0.2
258 0.18
259 0.17
260 0.15
261 0.21
262 0.22