Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LPR4

Protein Details
Accession A0A015LPR4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-39TSSPHDLPLKKNSRKKKLSKTSVAFTEHydrophilic
NLS Segment(s)
PositionSequence
23-29KNSRKKK
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MPSAKIGGVSGITSSPHDLPLKKNSRKKKLSKTSVAFTETDNTINHTPSNDNISKMGSELEKVLKKMDDIAYARFYESIYPLSKQLNGLNNKLVFQITCERKSHVDLNAKQLKEIESLKSKINLKDSEITSLEVRINELEARLLASSKSEKLCENFTYDPSCSSIEQENNSSLEIRVKELKNELEKVTQNSSFKDGLIFCLRSRVSDLERKAKKDELDQFASQLHQISHDSKIGSAEADYETKISETLCSRKNLPIENPSSSNYKYSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.18
4 0.22
5 0.24
6 0.28
7 0.38
8 0.48
9 0.54
10 0.63
11 0.69
12 0.75
13 0.83
14 0.88
15 0.89
16 0.9
17 0.9
18 0.92
19 0.88
20 0.84
21 0.79
22 0.72
23 0.61
24 0.52
25 0.46
26 0.36
27 0.32
28 0.24
29 0.23
30 0.22
31 0.22
32 0.21
33 0.18
34 0.19
35 0.19
36 0.27
37 0.24
38 0.23
39 0.23
40 0.24
41 0.22
42 0.21
43 0.21
44 0.13
45 0.12
46 0.13
47 0.19
48 0.21
49 0.21
50 0.23
51 0.21
52 0.21
53 0.25
54 0.25
55 0.25
56 0.24
57 0.26
58 0.27
59 0.27
60 0.27
61 0.22
62 0.2
63 0.15
64 0.14
65 0.15
66 0.14
67 0.14
68 0.16
69 0.17
70 0.18
71 0.19
72 0.22
73 0.26
74 0.28
75 0.29
76 0.33
77 0.32
78 0.31
79 0.3
80 0.25
81 0.17
82 0.16
83 0.23
84 0.23
85 0.27
86 0.27
87 0.29
88 0.3
89 0.33
90 0.34
91 0.33
92 0.37
93 0.35
94 0.44
95 0.48
96 0.46
97 0.43
98 0.4
99 0.34
100 0.28
101 0.28
102 0.22
103 0.21
104 0.22
105 0.24
106 0.27
107 0.3
108 0.29
109 0.33
110 0.3
111 0.28
112 0.32
113 0.31
114 0.3
115 0.27
116 0.25
117 0.2
118 0.2
119 0.18
120 0.12
121 0.12
122 0.08
123 0.08
124 0.07
125 0.07
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.08
134 0.1
135 0.11
136 0.12
137 0.13
138 0.15
139 0.19
140 0.18
141 0.22
142 0.2
143 0.21
144 0.23
145 0.22
146 0.21
147 0.19
148 0.2
149 0.15
150 0.16
151 0.18
152 0.18
153 0.19
154 0.2
155 0.2
156 0.19
157 0.19
158 0.18
159 0.14
160 0.15
161 0.14
162 0.15
163 0.21
164 0.21
165 0.22
166 0.25
167 0.3
168 0.3
169 0.33
170 0.32
171 0.31
172 0.33
173 0.34
174 0.35
175 0.34
176 0.31
177 0.3
178 0.32
179 0.27
180 0.24
181 0.24
182 0.19
183 0.2
184 0.24
185 0.24
186 0.2
187 0.26
188 0.26
189 0.24
190 0.27
191 0.27
192 0.26
193 0.33
194 0.38
195 0.42
196 0.47
197 0.5
198 0.5
199 0.51
200 0.48
201 0.49
202 0.53
203 0.5
204 0.51
205 0.48
206 0.45
207 0.41
208 0.4
209 0.32
210 0.25
211 0.17
212 0.13
213 0.16
214 0.17
215 0.19
216 0.21
217 0.2
218 0.19
219 0.2
220 0.18
221 0.16
222 0.14
223 0.13
224 0.12
225 0.13
226 0.13
227 0.11
228 0.12
229 0.11
230 0.12
231 0.1
232 0.12
233 0.16
234 0.23
235 0.28
236 0.32
237 0.34
238 0.4
239 0.45
240 0.48
241 0.5
242 0.52
243 0.52
244 0.55
245 0.55
246 0.51
247 0.51
248 0.46