Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LCS7

Protein Details
Accession A0A015LCS7    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21GKSAKFYKRLSKKEKIVQSIHydrophilic
52-80KPSATTKITKKQNKRKKVKAVTNGNGNKNHydrophilic
NLS Segment(s)
PositionSequence
61-70KKQNKRKKVK
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MGKSAKFYKRLSKKEKIVQSIISNNDNNNNNIKSESQSSILLSSQDSLNSAKPSATTKITKKQNKRKKVKAVTNGNGNKNNEKDYVDIFTGKKLYKSLIGRDEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.8
4 0.73
5 0.68
6 0.65
7 0.61
8 0.56
9 0.51
10 0.43
11 0.37
12 0.4
13 0.37
14 0.33
15 0.32
16 0.29
17 0.25
18 0.25
19 0.25
20 0.21
21 0.22
22 0.22
23 0.18
24 0.18
25 0.18
26 0.17
27 0.17
28 0.14
29 0.11
30 0.1
31 0.08
32 0.08
33 0.08
34 0.08
35 0.1
36 0.1
37 0.1
38 0.09
39 0.1
40 0.12
41 0.13
42 0.16
43 0.19
44 0.23
45 0.32
46 0.42
47 0.5
48 0.58
49 0.67
50 0.73
51 0.79
52 0.85
53 0.86
54 0.88
55 0.9
56 0.89
57 0.88
58 0.88
59 0.83
60 0.83
61 0.8
62 0.76
63 0.72
64 0.65
65 0.61
66 0.52
67 0.5
68 0.41
69 0.36
70 0.31
71 0.27
72 0.28
73 0.24
74 0.25
75 0.22
76 0.24
77 0.27
78 0.26
79 0.26
80 0.23
81 0.24
82 0.29
83 0.33
84 0.38