Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L0W8

Protein Details
Accession A0A015L0W8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71LEYMTKKYIKPRKAEKSNTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010734  Copine_C  
Pfam View protein in Pfam  
PF07002  Copine  
Amino Acid Sequences MYTLANRLVNHDWKEREPRDIVHFVEMKKFVESGMNKDLPKAVLEEIPDQILEYMTKKYIKPRKAEKSNTFYEAFNDQSPPPYSER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.51
4 0.47
5 0.46
6 0.46
7 0.46
8 0.41
9 0.37
10 0.38
11 0.33
12 0.36
13 0.34
14 0.28
15 0.24
16 0.23
17 0.17
18 0.2
19 0.21
20 0.2
21 0.25
22 0.28
23 0.27
24 0.28
25 0.28
26 0.22
27 0.21
28 0.17
29 0.12
30 0.09
31 0.11
32 0.12
33 0.11
34 0.11
35 0.1
36 0.09
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.1
43 0.12
44 0.13
45 0.23
46 0.32
47 0.37
48 0.45
49 0.54
50 0.63
51 0.71
52 0.8
53 0.8
54 0.78
55 0.77
56 0.73
57 0.64
58 0.54
59 0.46
60 0.4
61 0.34
62 0.28
63 0.26
64 0.22
65 0.26
66 0.28