Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015ILE5

Protein Details
Accession A0A015ILE5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
12-55ETIRKRKAKAQEMPEQRQARLNRESERKRQKRNNKKEMERDDEHBasic
NLS Segment(s)
PositionSequence
15-47RKRKAKAQEMPEQRQARLNRESERKRQKRNNKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.833, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046700  DUF6570  
Pfam View protein in Pfam  
PF20209  DUF6570  
Amino Acid Sequences MSDNTYENVNPETIRKRKAKAQEMPEQRQARLNRESERKRQKRNNKKEMERDDEHVICLAHESNRKRVLRAHNKNQLQDQQINESNDNEHIQRKPDNRNMHVRSTSSTKISENDHKVLQKFCNKMDNIQYNTCPECNERISNMTLIMGECRHYHNDKKTPKKFSADNNMDPGEVPDELQGLTDIEEMLIAQVFMVMSVYRLQGGQNSYKGNVINFPQDVREFTRHLPRNPSSLDVLVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.49
4 0.56
5 0.66
6 0.7
7 0.7
8 0.72
9 0.74
10 0.78
11 0.8
12 0.81
13 0.74
14 0.64
15 0.63
16 0.58
17 0.55
18 0.53
19 0.51
20 0.5
21 0.57
22 0.64
23 0.67
24 0.74
25 0.77
26 0.8
27 0.85
28 0.88
29 0.89
30 0.93
31 0.93
32 0.92
33 0.92
34 0.92
35 0.9
36 0.88
37 0.79
38 0.73
39 0.68
40 0.58
41 0.49
42 0.4
43 0.31
44 0.22
45 0.2
46 0.17
47 0.14
48 0.2
49 0.23
50 0.29
51 0.37
52 0.38
53 0.38
54 0.44
55 0.51
56 0.56
57 0.64
58 0.66
59 0.68
60 0.72
61 0.73
62 0.71
63 0.66
64 0.6
65 0.54
66 0.45
67 0.41
68 0.42
69 0.41
70 0.36
71 0.3
72 0.26
73 0.24
74 0.23
75 0.18
76 0.17
77 0.16
78 0.18
79 0.24
80 0.29
81 0.35
82 0.42
83 0.48
84 0.49
85 0.58
86 0.59
87 0.58
88 0.55
89 0.47
90 0.42
91 0.39
92 0.37
93 0.28
94 0.26
95 0.21
96 0.21
97 0.24
98 0.29
99 0.28
100 0.29
101 0.29
102 0.3
103 0.31
104 0.32
105 0.33
106 0.32
107 0.29
108 0.29
109 0.33
110 0.31
111 0.33
112 0.38
113 0.4
114 0.37
115 0.37
116 0.36
117 0.32
118 0.33
119 0.3
120 0.23
121 0.18
122 0.18
123 0.18
124 0.19
125 0.17
126 0.19
127 0.2
128 0.19
129 0.18
130 0.14
131 0.11
132 0.1
133 0.1
134 0.08
135 0.08
136 0.08
137 0.1
138 0.14
139 0.18
140 0.24
141 0.32
142 0.41
143 0.49
144 0.59
145 0.65
146 0.69
147 0.7
148 0.69
149 0.66
150 0.65
151 0.67
152 0.64
153 0.59
154 0.56
155 0.52
156 0.46
157 0.41
158 0.33
159 0.24
160 0.16
161 0.13
162 0.08
163 0.08
164 0.08
165 0.08
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.05
172 0.05
173 0.05
174 0.05
175 0.04
176 0.03
177 0.03
178 0.04
179 0.03
180 0.03
181 0.04
182 0.04
183 0.05
184 0.06
185 0.07
186 0.07
187 0.08
188 0.08
189 0.12
190 0.16
191 0.2
192 0.23
193 0.26
194 0.26
195 0.29
196 0.29
197 0.26
198 0.27
199 0.24
200 0.26
201 0.25
202 0.25
203 0.26
204 0.27
205 0.29
206 0.31
207 0.32
208 0.3
209 0.34
210 0.43
211 0.47
212 0.51
213 0.57
214 0.54
215 0.57
216 0.56
217 0.55
218 0.48