Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L913

Protein Details
Accession A0A015L913   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-87AKEKLKSKSKFSAKRNKRNNELKAFFHydrophilic
NLS Segment(s)
PositionSequence
63-79KEKLKSKSKFSAKRNKR
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MVCPWCQRVENPECPQCNLAKNFGLKLSPPIPPQTTLPKTNPNQPNNSGKKQPPSEQSINSAKEKLKSKSKFSAKRNKRNNELKAFFKNLPTNPKEFIEFLENIKVGLSKKLTSEEIDNLCQAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.5
4 0.5
5 0.43
6 0.39
7 0.36
8 0.36
9 0.35
10 0.34
11 0.32
12 0.25
13 0.28
14 0.26
15 0.25
16 0.25
17 0.28
18 0.29
19 0.29
20 0.31
21 0.35
22 0.37
23 0.38
24 0.4
25 0.45
26 0.45
27 0.53
28 0.59
29 0.53
30 0.54
31 0.54
32 0.6
33 0.58
34 0.61
35 0.58
36 0.52
37 0.55
38 0.54
39 0.54
40 0.49
41 0.5
42 0.49
43 0.44
44 0.46
45 0.44
46 0.43
47 0.39
48 0.36
49 0.29
50 0.31
51 0.35
52 0.33
53 0.37
54 0.38
55 0.43
56 0.5
57 0.59
58 0.62
59 0.66
60 0.73
61 0.74
62 0.8
63 0.85
64 0.83
65 0.83
66 0.84
67 0.83
68 0.83
69 0.76
70 0.72
71 0.67
72 0.65
73 0.56
74 0.52
75 0.49
76 0.43
77 0.48
78 0.45
79 0.43
80 0.41
81 0.41
82 0.38
83 0.32
84 0.3
85 0.27
86 0.25
87 0.23
88 0.26
89 0.24
90 0.22
91 0.21
92 0.21
93 0.17
94 0.21
95 0.22
96 0.18
97 0.2
98 0.24
99 0.26
100 0.26
101 0.3
102 0.31
103 0.33
104 0.34