Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JY13

Protein Details
Accession A0A015JY13   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-79KTFQRFKKFYKDKYPSRRPKLLHBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045093  Cullin  
IPR016158  Cullin_homology  
IPR036317  Cullin_homology_sf  
IPR001373  Cullin_N  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0031625  F:ubiquitin protein ligase binding  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00888  Cullin  
PROSITE View protein in PROSITE  
PS50069  CULLIN_2  
Amino Acid Sequences MRLLFHNIGLSKDLNNQFKKHLNTDDAEQVEFYILDMEALPMSPVVSNLIIPDEIEKTFQRFKKFYKDKYPSRRPKLLHHLSKGELKANYLKTPKVFQASTYQMSILLQYNNNTSYTREELLQNTGINQDLLDQQLKYLTDLKLLLLDKTTYDLNFEFNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.41
4 0.45
5 0.51
6 0.55
7 0.52
8 0.5
9 0.46
10 0.45
11 0.46
12 0.48
13 0.41
14 0.37
15 0.3
16 0.24
17 0.21
18 0.18
19 0.14
20 0.08
21 0.06
22 0.06
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.04
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.11
43 0.11
44 0.14
45 0.21
46 0.24
47 0.29
48 0.3
49 0.34
50 0.43
51 0.5
52 0.54
53 0.58
54 0.64
55 0.68
56 0.76
57 0.83
58 0.83
59 0.82
60 0.82
61 0.73
62 0.73
63 0.74
64 0.73
65 0.68
66 0.62
67 0.57
68 0.52
69 0.54
70 0.46
71 0.39
72 0.29
73 0.24
74 0.26
75 0.24
76 0.27
77 0.24
78 0.25
79 0.23
80 0.25
81 0.26
82 0.25
83 0.23
84 0.2
85 0.25
86 0.28
87 0.29
88 0.27
89 0.24
90 0.2
91 0.2
92 0.2
93 0.15
94 0.12
95 0.11
96 0.12
97 0.14
98 0.15
99 0.16
100 0.15
101 0.15
102 0.17
103 0.19
104 0.19
105 0.19
106 0.2
107 0.21
108 0.24
109 0.25
110 0.2
111 0.18
112 0.18
113 0.17
114 0.14
115 0.12
116 0.1
117 0.09
118 0.12
119 0.13
120 0.12
121 0.11
122 0.15
123 0.15
124 0.16
125 0.19
126 0.17
127 0.18
128 0.19
129 0.19
130 0.21
131 0.22
132 0.21
133 0.18
134 0.18
135 0.16
136 0.18
137 0.19
138 0.14
139 0.17
140 0.16