Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KBJ8

Protein Details
Accession A0A015KBJ8   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-71VDWVIKKKSKEKKKETAAKKHQTAYHydrophilic
NLS Segment(s)
PositionSequence
52-66KKKSKEKKKETAAKK
Subcellular Location(s) mito 12, nucl 10, cyto 2.5, cyto_pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044044  DUF5679  
Pfam View protein in Pfam  
PF18930  DUF5679  
Amino Acid Sequences MTRFYCLKCKKETETTSEIQDMTTNGRYHLYGDCTVCGMHKNTFTGVDWVIKKKSKEKKKETAAKKHQTAYNQQCQKLGQKILDADNTSGGGYSNEHDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.54
4 0.49
5 0.42
6 0.32
7 0.28
8 0.21
9 0.19
10 0.22
11 0.18
12 0.17
13 0.18
14 0.18
15 0.19
16 0.2
17 0.2
18 0.18
19 0.18
20 0.18
21 0.17
22 0.17
23 0.16
24 0.15
25 0.14
26 0.13
27 0.14
28 0.14
29 0.14
30 0.16
31 0.16
32 0.15
33 0.14
34 0.16
35 0.16
36 0.17
37 0.2
38 0.22
39 0.23
40 0.3
41 0.39
42 0.45
43 0.54
44 0.61
45 0.68
46 0.75
47 0.83
48 0.84
49 0.86
50 0.87
51 0.85
52 0.81
53 0.77
54 0.69
55 0.64
56 0.65
57 0.62
58 0.62
59 0.59
60 0.55
61 0.52
62 0.51
63 0.53
64 0.49
65 0.44
66 0.36
67 0.33
68 0.35
69 0.37
70 0.39
71 0.35
72 0.28
73 0.26
74 0.24
75 0.2
76 0.17
77 0.14
78 0.1
79 0.1