Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015J782

Protein Details
Accession A0A015J782   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MKMVHKRSQNKLQERKNKSFSNNKRKRDKVNSLNETHydrophilic
NLS Segment(s)
PositionSequence
24-26KRK
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
Amino Acid Sequences MKMVHKRSQNKLQERKNKSFSNNKRKRDKVNSLNETIENKDKEITQLKRQKTFAVELYQQKLNQIIEIENKLENNCKCIENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.84
4 0.8
5 0.77
6 0.78
7 0.78
8 0.79
9 0.8
10 0.8
11 0.82
12 0.82
13 0.85
14 0.84
15 0.83
16 0.82
17 0.83
18 0.79
19 0.72
20 0.67
21 0.59
22 0.5
23 0.42
24 0.37
25 0.27
26 0.22
27 0.19
28 0.17
29 0.19
30 0.25
31 0.26
32 0.3
33 0.38
34 0.42
35 0.47
36 0.48
37 0.47
38 0.42
39 0.42
40 0.36
41 0.34
42 0.36
43 0.35
44 0.38
45 0.39
46 0.36
47 0.33
48 0.32
49 0.27
50 0.23
51 0.19
52 0.17
53 0.19
54 0.21
55 0.22
56 0.2
57 0.21
58 0.21
59 0.28
60 0.26
61 0.25
62 0.25