Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JSN6

Protein Details
Accession A0A015JSN6    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
175-194EDLHRREITRRNRKFDKATSBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, cyto 11, nucl 10, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR024706  Peroxiredoxin_AhpC-typ  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0004601  F:peroxidase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
Amino Acid Sequences MFSNNVILFKPIPKFDILYVENGLFDDFTFDKYLGKYVVLFFYDIKNNPEVFPDEIITISKNRKIFEELNVVLLAVSNDNVFTLTSLILHNHLIHYEQNPVNLNVNIDFPLLADKNNEIALYFNVWNFKNPHLYQKKVIIINPQGIIKKNFDSSIKKNIDKVIKSIREFKFTDAEDLHRREITRRNRKFDKATS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.32
4 0.28
5 0.27
6 0.28
7 0.26
8 0.24
9 0.22
10 0.21
11 0.12
12 0.1
13 0.11
14 0.09
15 0.11
16 0.13
17 0.12
18 0.14
19 0.15
20 0.17
21 0.14
22 0.14
23 0.13
24 0.13
25 0.16
26 0.15
27 0.15
28 0.14
29 0.17
30 0.21
31 0.22
32 0.23
33 0.23
34 0.23
35 0.23
36 0.24
37 0.23
38 0.2
39 0.2
40 0.18
41 0.15
42 0.15
43 0.15
44 0.14
45 0.14
46 0.16
47 0.18
48 0.2
49 0.2
50 0.21
51 0.26
52 0.27
53 0.28
54 0.34
55 0.3
56 0.29
57 0.28
58 0.26
59 0.2
60 0.18
61 0.14
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.13
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.17
90 0.16
91 0.11
92 0.12
93 0.1
94 0.09
95 0.08
96 0.06
97 0.09
98 0.08
99 0.08
100 0.08
101 0.08
102 0.09
103 0.1
104 0.1
105 0.07
106 0.07
107 0.08
108 0.1
109 0.1
110 0.1
111 0.13
112 0.14
113 0.17
114 0.18
115 0.2
116 0.25
117 0.25
118 0.35
119 0.39
120 0.42
121 0.43
122 0.48
123 0.52
124 0.46
125 0.47
126 0.44
127 0.41
128 0.41
129 0.39
130 0.35
131 0.32
132 0.32
133 0.33
134 0.28
135 0.27
136 0.25
137 0.26
138 0.28
139 0.33
140 0.35
141 0.43
142 0.47
143 0.46
144 0.47
145 0.52
146 0.55
147 0.49
148 0.51
149 0.51
150 0.52
151 0.53
152 0.6
153 0.56
154 0.53
155 0.53
156 0.5
157 0.46
158 0.4
159 0.43
160 0.35
161 0.39
162 0.4
163 0.43
164 0.43
165 0.38
166 0.38
167 0.38
168 0.45
169 0.5
170 0.53
171 0.59
172 0.66
173 0.71
174 0.79