Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JW42

Protein Details
Accession A0A0D8JW42    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPHKRQLKSKREEMRRSSADBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012816  NADAR  
IPR037238  YbiA-like_sf  
KEGG cim:CIMG_11500  -  
Pfam View protein in Pfam  
PF08719  NADAR  
CDD cd15457  NADAR  
Amino Acid Sequences MPHKRQLKSKREEMRRSSADDGPVYFWKPEQENGFLGQWYESKFTVTQPGDEDDAKNVEITYMNCEHYMMHRKGVLFAPDDSITQEIASVDKPVPHPSTLRSLGRKVPNFDEKLWNKERLRIVVEGNYLKFTQNEDLKAQLLATGDRELIEASPRDRIWGVGFGAKNAGAMRHRWGLNLLGKALMEVRERIRSEQQKTPVDSDGIEGSKAKRMKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.78
3 0.75
4 0.7
5 0.63
6 0.57
7 0.49
8 0.43
9 0.37
10 0.35
11 0.31
12 0.27
13 0.23
14 0.24
15 0.24
16 0.28
17 0.28
18 0.28
19 0.28
20 0.3
21 0.31
22 0.26
23 0.24
24 0.2
25 0.18
26 0.17
27 0.18
28 0.14
29 0.15
30 0.16
31 0.17
32 0.25
33 0.23
34 0.23
35 0.23
36 0.25
37 0.25
38 0.26
39 0.25
40 0.18
41 0.19
42 0.17
43 0.15
44 0.12
45 0.1
46 0.11
47 0.11
48 0.14
49 0.15
50 0.15
51 0.15
52 0.15
53 0.15
54 0.19
55 0.28
56 0.24
57 0.24
58 0.26
59 0.26
60 0.28
61 0.3
62 0.27
63 0.19
64 0.19
65 0.19
66 0.18
67 0.18
68 0.16
69 0.14
70 0.12
71 0.09
72 0.09
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.09
79 0.1
80 0.14
81 0.16
82 0.16
83 0.17
84 0.17
85 0.23
86 0.26
87 0.29
88 0.27
89 0.28
90 0.34
91 0.4
92 0.41
93 0.37
94 0.38
95 0.4
96 0.4
97 0.39
98 0.42
99 0.37
100 0.41
101 0.42
102 0.45
103 0.39
104 0.42
105 0.43
106 0.36
107 0.37
108 0.32
109 0.3
110 0.25
111 0.28
112 0.24
113 0.22
114 0.2
115 0.18
116 0.17
117 0.15
118 0.14
119 0.16
120 0.17
121 0.19
122 0.19
123 0.2
124 0.2
125 0.19
126 0.17
127 0.13
128 0.11
129 0.09
130 0.1
131 0.09
132 0.09
133 0.09
134 0.09
135 0.08
136 0.08
137 0.1
138 0.1
139 0.1
140 0.15
141 0.14
142 0.16
143 0.16
144 0.17
145 0.16
146 0.18
147 0.18
148 0.19
149 0.19
150 0.18
151 0.19
152 0.18
153 0.17
154 0.14
155 0.16
156 0.12
157 0.14
158 0.18
159 0.23
160 0.23
161 0.23
162 0.25
163 0.28
164 0.32
165 0.32
166 0.28
167 0.23
168 0.22
169 0.22
170 0.22
171 0.19
172 0.15
173 0.16
174 0.19
175 0.26
176 0.28
177 0.32
178 0.4
179 0.46
180 0.5
181 0.55
182 0.6
183 0.61
184 0.63
185 0.62
186 0.55
187 0.48
188 0.42
189 0.36
190 0.33
191 0.26
192 0.23
193 0.21
194 0.2
195 0.26