Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015K5P7

Protein Details
Accession A0A015K5P7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MFLKKIRANKKQHKKSNFRLRKSRDTHSNNNSHydrophilic
NLS Segment(s)
PositionSequence
4-22KKIRANKKQHKKSNFRLRK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.333, cyto_mito 5.833, mito 5.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MFLKKIRANKKQHKKSNFRLRKSRDTHSNNNSSISNHTIILDKQQNICENNTSSQSNTNNFYYKINESINNNHDTSKNNKDSYHNFNDFNEDLIDDDFTEIYDTGEEFNNIDENVNGNSDIYGEFNYIDEDFTENCDTNGKFNGREYDNNKKQNCYSGDAGPYFPNFTIFLLFLWVIKHQIGICFYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.93
4 0.93
5 0.91
6 0.91
7 0.89
8 0.89
9 0.85
10 0.83
11 0.82
12 0.8
13 0.8
14 0.79
15 0.79
16 0.7
17 0.66
18 0.58
19 0.49
20 0.44
21 0.38
22 0.29
23 0.21
24 0.21
25 0.2
26 0.19
27 0.25
28 0.28
29 0.26
30 0.27
31 0.31
32 0.34
33 0.34
34 0.36
35 0.32
36 0.28
37 0.28
38 0.29
39 0.26
40 0.23
41 0.26
42 0.28
43 0.27
44 0.28
45 0.28
46 0.27
47 0.27
48 0.27
49 0.25
50 0.23
51 0.24
52 0.23
53 0.23
54 0.24
55 0.29
56 0.32
57 0.31
58 0.3
59 0.27
60 0.27
61 0.27
62 0.3
63 0.32
64 0.34
65 0.33
66 0.34
67 0.37
68 0.41
69 0.47
70 0.49
71 0.43
72 0.38
73 0.37
74 0.39
75 0.34
76 0.3
77 0.22
78 0.14
79 0.11
80 0.1
81 0.1
82 0.05
83 0.05
84 0.04
85 0.04
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.06
94 0.05
95 0.06
96 0.06
97 0.06
98 0.06
99 0.05
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.06
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.11
120 0.12
121 0.11
122 0.12
123 0.15
124 0.15
125 0.16
126 0.21
127 0.2
128 0.2
129 0.22
130 0.29
131 0.29
132 0.36
133 0.41
134 0.46
135 0.53
136 0.61
137 0.6
138 0.58
139 0.56
140 0.57
141 0.54
142 0.49
143 0.43
144 0.39
145 0.42
146 0.39
147 0.39
148 0.33
149 0.3
150 0.27
151 0.23
152 0.2
153 0.16
154 0.15
155 0.15
156 0.14
157 0.13
158 0.14
159 0.14
160 0.13
161 0.13
162 0.14
163 0.14
164 0.13
165 0.16
166 0.13
167 0.17