Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015K5P7

Protein Details
Accession A0A015K5P7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MFLKKIRANKKQHKKSNFRLRKSRDTHSNNNSHydrophilic
NLS Segment(s)
PositionSequence
4-22KKIRANKKQHKKSNFRLRK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.333, cyto_mito 5.833, mito 5.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MFLKKIRANKKQHKKSNFRLRKSRDTHSNNNSSISNHTIILDKQQNICENNTSSQSNTNNFYYKINESINNNHDTSKNNKDSYHNFNDFNEDLIDDDFTEIYDTGEEFNNIDENVNGNSDIYGEFNYIDEDFTENCDTNGKFNGREYDNNKKQNCYSGDAGPYFPNFTIFLLFLWVIKHQIGICFYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.93
4 0.93
5 0.91
6 0.91
7 0.89
8 0.89
9 0.85
10 0.83
11 0.82
12 0.8
13 0.8
14 0.79
15 0.79
16 0.7
17 0.66
18 0.58
19 0.49
20 0.44
21 0.38
22 0.29
23 0.21
24 0.21
25 0.2
26 0.19
27 0.25
28 0.28
29 0.26
30 0.27
31 0.31
32 0.34
33 0.34
34 0.36
35 0.32
36 0.28
37 0.28
38 0.29
39 0.26
40 0.23
41 0.26
42 0.28
43 0.27
44 0.28
45 0.28
46 0.27
47 0.27
48 0.27
49 0.25
50 0.23
51 0.24
52 0.23
53 0.23
54 0.24
55 0.29
56 0.32
57 0.31
58 0.3
59 0.27
60 0.27
61 0.27
62 0.3
63 0.32
64 0.34
65 0.33
66 0.34
67 0.37
68 0.41
69 0.47
70 0.49
71 0.43
72 0.38
73 0.37
74 0.39
75 0.34
76 0.3
77 0.22
78 0.14
79 0.11
80 0.1
81 0.1
82 0.05
83 0.05
84 0.04
85 0.04
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.06
94 0.05
95 0.06
96 0.06
97 0.06
98 0.06
99 0.05
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.06
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.11
120 0.12
121 0.11
122 0.12
123 0.15
124 0.15
125 0.16
126 0.21
127 0.2
128 0.2
129 0.22
130 0.29
131 0.29
132 0.36
133 0.41
134 0.46
135 0.53
136 0.61
137 0.6
138 0.58
139 0.56
140 0.57
141 0.54
142 0.49
143 0.43
144 0.39
145 0.42
146 0.39
147 0.39
148 0.33
149 0.3
150 0.27
151 0.23
152 0.2
153 0.16
154 0.15
155 0.15
156 0.14
157 0.13
158 0.14
159 0.14
160 0.13
161 0.13
162 0.14
163 0.14
164 0.13
165 0.16
166 0.13
167 0.17