Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015K096

Protein Details
Accession A0A015K096    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKPTSKRGKSTPKKRKKLTDELVVPWHydrophilic
77-101KYYHNDLNQHKKQRRNDNQTDQDVNHydrophilic
NLS Segment(s)
PositionSequence
5-17SKRGKSTPKKRKK
Subcellular Location(s) nucl 17.5, mito_nucl 13.5, mito 8.5
Family & Domain DBs
Amino Acid Sequences MKPTSKRGKSTPKKRKKLTDELVVPWVKKLEQIDSLNRSNHGELSINFREYFMSFCKRLESETTYQIREENFFVAMKYYHNDLNQHKKQRRNDNQTDQDVNMNMNFNDTPDFFRNIFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.91
4 0.91
5 0.88
6 0.87
7 0.81
8 0.73
9 0.72
10 0.63
11 0.54
12 0.44
13 0.37
14 0.26
15 0.24
16 0.22
17 0.18
18 0.23
19 0.26
20 0.32
21 0.36
22 0.39
23 0.38
24 0.37
25 0.35
26 0.29
27 0.26
28 0.2
29 0.17
30 0.14
31 0.21
32 0.22
33 0.21
34 0.2
35 0.2
36 0.19
37 0.17
38 0.19
39 0.14
40 0.16
41 0.15
42 0.16
43 0.18
44 0.17
45 0.18
46 0.19
47 0.21
48 0.19
49 0.26
50 0.28
51 0.27
52 0.27
53 0.27
54 0.24
55 0.21
56 0.19
57 0.12
58 0.11
59 0.1
60 0.1
61 0.1
62 0.1
63 0.09
64 0.1
65 0.11
66 0.13
67 0.14
68 0.2
69 0.26
70 0.36
71 0.43
72 0.52
73 0.57
74 0.63
75 0.71
76 0.77
77 0.81
78 0.81
79 0.83
80 0.83
81 0.85
82 0.84
83 0.78
84 0.68
85 0.6
86 0.5
87 0.41
88 0.32
89 0.26
90 0.19
91 0.18
92 0.17
93 0.14
94 0.17
95 0.17
96 0.21
97 0.22
98 0.27