Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IGX5

Protein Details
Accession A0A015IGX5   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-107DASIPSPKNNKKRKIQVEQRELTDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 11.666, cyto_nucl 11.333, mito 4.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003656  Znf_BED  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF02892  zf-BED  
Amino Acid Sequences MNSQQKEKKPSGRPQSEVWKHFEKKPLKSAGHFSAKCNYCKTFWARGHPQQLEEHLANNCKECPELVYAFYLGVVSSRDFGSEDASIPSPKNNKKRKIQVEQRELTDWFAVCQNNSSKRSFHYSGSRVRIYVLWDIVFNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.77
4 0.71
5 0.67
6 0.65
7 0.6
8 0.62
9 0.64
10 0.6
11 0.58
12 0.63
13 0.65
14 0.59
15 0.59
16 0.61
17 0.6
18 0.63
19 0.57
20 0.51
21 0.51
22 0.51
23 0.5
24 0.47
25 0.41
26 0.32
27 0.37
28 0.4
29 0.41
30 0.4
31 0.47
32 0.51
33 0.56
34 0.64
35 0.59
36 0.55
37 0.47
38 0.45
39 0.41
40 0.33
41 0.28
42 0.21
43 0.23
44 0.21
45 0.2
46 0.18
47 0.14
48 0.14
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.08
59 0.05
60 0.05
61 0.05
62 0.04
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.09
69 0.08
70 0.09
71 0.09
72 0.11
73 0.11
74 0.11
75 0.15
76 0.2
77 0.28
78 0.37
79 0.45
80 0.53
81 0.62
82 0.72
83 0.78
84 0.81
85 0.84
86 0.85
87 0.86
88 0.81
89 0.75
90 0.67
91 0.58
92 0.49
93 0.4
94 0.29
95 0.2
96 0.2
97 0.18
98 0.15
99 0.19
100 0.24
101 0.3
102 0.33
103 0.35
104 0.33
105 0.36
106 0.44
107 0.42
108 0.41
109 0.43
110 0.46
111 0.53
112 0.59
113 0.57
114 0.49
115 0.48
116 0.44
117 0.37
118 0.36
119 0.3
120 0.23