Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015N3V3

Protein Details
Accession A0A015N3V3   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-66DMKFVKPRLSRRKKNVETQTMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018819  Nur1/Mug154  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10332  DUF2418  
Amino Acid Sequences MNKGTEIYSIILAGFLALQMYFYAEKFITLVRDKEIVFREIQREYDMKFVKPRLSRRKKNVETQTMSQEEMMKELLCIKSDYEHYKFPRKFDNPWVTNFGTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.04
4 0.03
5 0.04
6 0.04
7 0.06
8 0.06
9 0.07
10 0.09
11 0.09
12 0.09
13 0.09
14 0.1
15 0.13
16 0.15
17 0.16
18 0.16
19 0.18
20 0.18
21 0.23
22 0.25
23 0.22
24 0.2
25 0.22
26 0.23
27 0.22
28 0.22
29 0.2
30 0.18
31 0.18
32 0.24
33 0.23
34 0.21
35 0.23
36 0.25
37 0.28
38 0.33
39 0.42
40 0.45
41 0.55
42 0.62
43 0.68
44 0.77
45 0.77
46 0.81
47 0.81
48 0.79
49 0.74
50 0.68
51 0.66
52 0.56
53 0.51
54 0.42
55 0.35
56 0.26
57 0.21
58 0.19
59 0.12
60 0.1
61 0.14
62 0.14
63 0.12
64 0.13
65 0.12
66 0.15
67 0.2
68 0.26
69 0.26
70 0.33
71 0.37
72 0.47
73 0.49
74 0.5
75 0.56
76 0.54
77 0.56
78 0.59
79 0.65
80 0.57
81 0.6
82 0.63