Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KE50

Protein Details
Accession A0A015KE50    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-40GKKMQANKRSVKKLSKRTTSKGKQRASKKAKHydrophilic
NLS Segment(s)
PositionSequence
11-40KKMQANKRSVKKLSKRTTSKGKQRASKKAK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSSKDKSDFGKKMQANKRSVKKLSKRTTSKGKQRASKKAKIDYDDDDTEMEIEERKIALEERKMQLKQNEIDLKLKELQIKKLEMELNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.69
4 0.74
5 0.73
6 0.76
7 0.76
8 0.77
9 0.8
10 0.82
11 0.82
12 0.8
13 0.79
14 0.82
15 0.82
16 0.82
17 0.81
18 0.79
19 0.77
20 0.78
21 0.81
22 0.79
23 0.77
24 0.73
25 0.72
26 0.69
27 0.63
28 0.58
29 0.5
30 0.48
31 0.4
32 0.34
33 0.25
34 0.21
35 0.18
36 0.14
37 0.11
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.11
46 0.16
47 0.22
48 0.25
49 0.32
50 0.33
51 0.38
52 0.4
53 0.43
54 0.39
55 0.43
56 0.45
57 0.41
58 0.45
59 0.41
60 0.41
61 0.38
62 0.39
63 0.37
64 0.34
65 0.39
66 0.4
67 0.42
68 0.39
69 0.41
70 0.45