Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JU08

Protein Details
Accession A0A015JU08    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
56-82ALRPRQYARISKRQKKVQRAYGGSRCAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRLTYRRRLSYNTKSNRVRVIKTPGGKLTWLYEKKPAKGPHCGDCGSRLSGIPALRPRQYARISKRQKKVQRAYGGSRCAGCVRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.74
4 0.72
5 0.75
6 0.7
7 0.63
8 0.59
9 0.59
10 0.57
11 0.55
12 0.55
13 0.48
14 0.44
15 0.41
16 0.35
17 0.3
18 0.32
19 0.3
20 0.28
21 0.34
22 0.36
23 0.38
24 0.45
25 0.48
26 0.42
27 0.48
28 0.5
29 0.47
30 0.47
31 0.45
32 0.37
33 0.34
34 0.33
35 0.25
36 0.22
37 0.16
38 0.14
39 0.16
40 0.16
41 0.17
42 0.2
43 0.23
44 0.24
45 0.27
46 0.28
47 0.32
48 0.38
49 0.43
50 0.46
51 0.53
52 0.62
53 0.69
54 0.77
55 0.8
56 0.83
57 0.85
58 0.87
59 0.86
60 0.85
61 0.83
62 0.83
63 0.8
64 0.76
65 0.68
66 0.58
67 0.51
68 0.43