Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KEI4

Protein Details
Accession A0A015KEI4    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-49RVNKQFKTLKEQEKYKKRFKNSLKSNKNKWQFTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 12.499, mito 4.5
Family & Domain DBs
Amino Acid Sequences MDGGTHKYAVTYSNLRVNKQFKTLKEQEKYKKRFKNSLKSNKNKWQFTNNGIESKVLISKHKLKRRSDILKKHYISEKEMEFLVDQVTSEIGYKMLKDDIFINHSFNEEHFLELRKKKEASFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.41
4 0.44
5 0.41
6 0.46
7 0.49
8 0.43
9 0.51
10 0.58
11 0.6
12 0.63
13 0.69
14 0.71
15 0.76
16 0.81
17 0.81
18 0.8
19 0.78
20 0.8
21 0.8
22 0.81
23 0.81
24 0.84
25 0.85
26 0.86
27 0.88
28 0.87
29 0.86
30 0.8
31 0.73
32 0.7
33 0.63
34 0.58
35 0.59
36 0.51
37 0.44
38 0.39
39 0.36
40 0.28
41 0.24
42 0.22
43 0.13
44 0.13
45 0.14
46 0.24
47 0.32
48 0.38
49 0.45
50 0.45
51 0.52
52 0.61
53 0.67
54 0.68
55 0.69
56 0.7
57 0.72
58 0.7
59 0.67
60 0.63
61 0.55
62 0.48
63 0.42
64 0.35
65 0.27
66 0.26
67 0.23
68 0.16
69 0.14
70 0.12
71 0.07
72 0.07
73 0.06
74 0.06
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.08
82 0.11
83 0.1
84 0.11
85 0.13
86 0.16
87 0.21
88 0.21
89 0.22
90 0.19
91 0.21
92 0.2
93 0.18
94 0.2
95 0.16
96 0.17
97 0.17
98 0.21
99 0.28
100 0.34
101 0.37
102 0.38
103 0.4