Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LC91

Protein Details
Accession A0A015LC91    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTRFSKRDKSWTKSIEKRYNKNLKKEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MTRFSKRDKSWTKSIEKRYNKNLKKEIFKVIENDTSNIELVKLYYFEIEVTVKVTEEVTEECNVNKCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.8
4 0.81
5 0.82
6 0.85
7 0.81
8 0.82
9 0.8
10 0.76
11 0.74
12 0.7
13 0.68
14 0.6
15 0.55
16 0.48
17 0.43
18 0.42
19 0.35
20 0.32
21 0.24
22 0.21
23 0.2
24 0.16
25 0.13
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.07
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.08
43 0.09
44 0.1
45 0.11
46 0.13
47 0.14
48 0.15