Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015NBC1

Protein Details
Accession A0A015NBC1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPKVKKSSRKKMGPYNKFMKSEHydrophilic
NLS Segment(s)
PositionSequence
9-9R
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKVKKSSRKKMGPYNKFMKSELVKVKEEHPTILHKDAFVMVAKRWKDAPENPKNQPKSDDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.8
4 0.73
5 0.65
6 0.61
7 0.53
8 0.51
9 0.5
10 0.46
11 0.4
12 0.39
13 0.42
14 0.41
15 0.39
16 0.32
17 0.25
18 0.25
19 0.26
20 0.29
21 0.25
22 0.18
23 0.18
24 0.17
25 0.17
26 0.15
27 0.13
28 0.11
29 0.17
30 0.18
31 0.19
32 0.2
33 0.22
34 0.26
35 0.34
36 0.43
37 0.47
38 0.55
39 0.62
40 0.7
41 0.72
42 0.69
43 0.68