Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L644

Protein Details
Accession A0A015L644   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-46SNKERFSSKKSSEKKKKIKTPNEEVVVHydrophilic
NLS Segment(s)
PositionSequence
27-38SKKSSEKKKKIK
Subcellular Location(s) nucl 22, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MRMPMTPPDRIYMELANFTSNKERFSSKKSSEKKKKIKTPNEEVVVDMIKNLRIENSKGEKEVEIEIGSAVSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.23
4 0.21
5 0.21
6 0.26
7 0.23
8 0.23
9 0.22
10 0.25
11 0.26
12 0.33
13 0.4
14 0.38
15 0.48
16 0.55
17 0.64
18 0.71
19 0.79
20 0.83
21 0.84
22 0.87
23 0.87
24 0.89
25 0.86
26 0.84
27 0.81
28 0.75
29 0.65
30 0.55
31 0.46
32 0.37
33 0.28
34 0.2
35 0.13
36 0.1
37 0.1
38 0.1
39 0.11
40 0.13
41 0.15
42 0.23
43 0.3
44 0.31
45 0.32
46 0.34
47 0.31
48 0.3
49 0.3
50 0.24
51 0.17
52 0.15
53 0.14
54 0.12