Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015IVU2

Protein Details
Accession A0A015IVU2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-82GTSGKGGNNNKKDKKSKKKVDSFVKLSIVHydrophilic
NLS Segment(s)
PositionSequence
62-72NNKKDKKSKKK
Subcellular Location(s) mito 10.5, cyto_mito 9.333, nucl 8.5, cyto_nucl 8.333, cyto 7
Family & Domain DBs
Amino Acid Sequences MNMQLGRENIGIISKNAITIVHKLTIEKFIANLSDNFKKMTISDKDIFTSINTGTSGKGGNNNKKDKKSKKKVDSFVKLSIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.13
5 0.12
6 0.14
7 0.17
8 0.17
9 0.17
10 0.17
11 0.19
12 0.22
13 0.21
14 0.17
15 0.15
16 0.13
17 0.13
18 0.14
19 0.14
20 0.15
21 0.18
22 0.18
23 0.19
24 0.18
25 0.17
26 0.16
27 0.21
28 0.19
29 0.22
30 0.24
31 0.24
32 0.24
33 0.25
34 0.24
35 0.18
36 0.17
37 0.11
38 0.1
39 0.1
40 0.09
41 0.09
42 0.1
43 0.1
44 0.09
45 0.17
46 0.24
47 0.33
48 0.41
49 0.51
50 0.58
51 0.66
52 0.76
53 0.79
54 0.83
55 0.85
56 0.87
57 0.88
58 0.91
59 0.92
60 0.93
61 0.92
62 0.86
63 0.82