Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015K961

Protein Details
Accession A0A015K961    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-91TGKVSICNKPKKKDKVPSLKPNKQNNNQLKASHydrophilic
NLS Segment(s)
PositionSequence
68-80KPKKKDKVPSLKP
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MQCGASAFKVIQTSKGRRKLVGYFKNWETTLKALNAAPVTLPSESTKAKNALIKKLSGNTGKVSICNKPKKKDKVPSLKPNKQNNNQLKASHVQKKAKNTLKSKDHDKDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.59
4 0.56
5 0.6
6 0.61
7 0.63
8 0.63
9 0.59
10 0.56
11 0.56
12 0.59
13 0.54
14 0.47
15 0.38
16 0.31
17 0.3
18 0.24
19 0.23
20 0.18
21 0.2
22 0.19
23 0.16
24 0.13
25 0.1
26 0.11
27 0.1
28 0.1
29 0.09
30 0.12
31 0.13
32 0.14
33 0.17
34 0.17
35 0.19
36 0.22
37 0.24
38 0.28
39 0.28
40 0.29
41 0.27
42 0.27
43 0.3
44 0.27
45 0.26
46 0.2
47 0.22
48 0.21
49 0.22
50 0.22
51 0.24
52 0.31
53 0.4
54 0.45
55 0.5
56 0.59
57 0.67
58 0.75
59 0.78
60 0.8
61 0.81
62 0.85
63 0.88
64 0.89
65 0.88
66 0.88
67 0.88
68 0.88
69 0.85
70 0.85
71 0.84
72 0.8
73 0.75
74 0.66
75 0.6
76 0.57
77 0.57
78 0.55
79 0.54
80 0.55
81 0.57
82 0.66
83 0.72
84 0.74
85 0.75
86 0.74
87 0.76
88 0.77
89 0.79
90 0.8