Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LEM7

Protein Details
Accession A0A015LEM7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-83FSTKIRKYKIRELKQGNELVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, cyto 12.5, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MTFILDIQSPPNLNQGGSSDLDDIDIRVKFITGLLPDNRKHVDEFGIKKPLKELVKYLVRDLMFSTKIRKYKIRELKQGNELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.18
5 0.19
6 0.14
7 0.13
8 0.14
9 0.13
10 0.12
11 0.12
12 0.11
13 0.1
14 0.09
15 0.09
16 0.08
17 0.08
18 0.1
19 0.08
20 0.12
21 0.15
22 0.2
23 0.2
24 0.23
25 0.24
26 0.23
27 0.22
28 0.19
29 0.2
30 0.21
31 0.25
32 0.27
33 0.35
34 0.34
35 0.34
36 0.34
37 0.37
38 0.33
39 0.3
40 0.28
41 0.27
42 0.35
43 0.36
44 0.36
45 0.34
46 0.31
47 0.3
48 0.3
49 0.27
50 0.22
51 0.22
52 0.27
53 0.28
54 0.33
55 0.38
56 0.43
57 0.45
58 0.54
59 0.64
60 0.68
61 0.72
62 0.76
63 0.8