Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LDL4

Protein Details
Accession A0A015LDL4   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-63KERVVKQKLLEIKKRKRREIDAKLKEQKSRBasic
120-147IRLEMSKVKPRIKKRKKKQHNTGPFTVVHydrophilic
NLS Segment(s)
PositionSequence
32-69KEKERVVKQKLLEIKKRKRREIDAKLKEQKSRKIAKLS
124-137MSKVKPRIKKRKKK
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
Amino Acid Sequences MFNSEGTTQRSDDEAPEVVSNSTSKIKALEIKEKERVVKQKLLEIKKRKRREIDAKLKEQKSRKIAKLSAVPNSNKKVDNIMKKIKEEGLPKFLPTELLEDFVNEDDKTKRRKQSEHTQIRLEMSKVKPRIKKRKKKQHNTGPFTVVALQDPDLDRPIPTPKEIMEFKDDHFYGERLPRKNAILNASQGIKGAAIRFCRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.18
5 0.16
6 0.16
7 0.15
8 0.15
9 0.17
10 0.16
11 0.16
12 0.16
13 0.19
14 0.25
15 0.3
16 0.37
17 0.4
18 0.46
19 0.52
20 0.54
21 0.55
22 0.56
23 0.59
24 0.55
25 0.54
26 0.49
27 0.5
28 0.55
29 0.6
30 0.62
31 0.65
32 0.69
33 0.73
34 0.81
35 0.83
36 0.82
37 0.83
38 0.85
39 0.85
40 0.85
41 0.84
42 0.85
43 0.86
44 0.82
45 0.79
46 0.74
47 0.7
48 0.68
49 0.68
50 0.63
51 0.62
52 0.6
53 0.59
54 0.61
55 0.56
56 0.54
57 0.51
58 0.49
59 0.46
60 0.48
61 0.45
62 0.38
63 0.35
64 0.36
65 0.37
66 0.42
67 0.44
68 0.49
69 0.49
70 0.48
71 0.5
72 0.45
73 0.42
74 0.39
75 0.35
76 0.33
77 0.3
78 0.29
79 0.28
80 0.25
81 0.22
82 0.17
83 0.17
84 0.1
85 0.11
86 0.11
87 0.1
88 0.11
89 0.1
90 0.1
91 0.07
92 0.08
93 0.1
94 0.15
95 0.21
96 0.27
97 0.34
98 0.38
99 0.44
100 0.51
101 0.59
102 0.66
103 0.7
104 0.67
105 0.63
106 0.59
107 0.56
108 0.49
109 0.39
110 0.35
111 0.28
112 0.32
113 0.35
114 0.41
115 0.46
116 0.55
117 0.66
118 0.7
119 0.78
120 0.81
121 0.87
122 0.91
123 0.95
124 0.96
125 0.95
126 0.95
127 0.92
128 0.86
129 0.78
130 0.66
131 0.56
132 0.47
133 0.36
134 0.25
135 0.18
136 0.14
137 0.13
138 0.13
139 0.13
140 0.13
141 0.13
142 0.12
143 0.13
144 0.2
145 0.2
146 0.2
147 0.21
148 0.2
149 0.26
150 0.28
151 0.3
152 0.29
153 0.28
154 0.29
155 0.36
156 0.34
157 0.3
158 0.31
159 0.28
160 0.27
161 0.34
162 0.4
163 0.35
164 0.39
165 0.41
166 0.42
167 0.47
168 0.47
169 0.44
170 0.41
171 0.41
172 0.41
173 0.39
174 0.35
175 0.3
176 0.25
177 0.21
178 0.18
179 0.18
180 0.19