Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LGI3

Protein Details
Accession A0A015LGI3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
62-82DDDHKNKDSDHKNKDNDHKKHBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 11.5, mito 6.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MDNNIFKSINKWLTWHLRNLRIKEKIQVVRFIVPFPQICVYQNNSKNNDHKNKDNDHNKNKDDDHKNKDSDHKNKDNDHKKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.5
4 0.54
5 0.61
6 0.64
7 0.66
8 0.62
9 0.6
10 0.57
11 0.59
12 0.57
13 0.52
14 0.52
15 0.46
16 0.44
17 0.43
18 0.38
19 0.3
20 0.25
21 0.23
22 0.19
23 0.18
24 0.13
25 0.14
26 0.16
27 0.19
28 0.24
29 0.3
30 0.34
31 0.36
32 0.4
33 0.45
34 0.51
35 0.57
36 0.53
37 0.55
38 0.56
39 0.59
40 0.65
41 0.69
42 0.71
43 0.71
44 0.75
45 0.69
46 0.68
47 0.65
48 0.66
49 0.65
50 0.64
51 0.63
52 0.63
53 0.64
54 0.62
55 0.68
56 0.68
57 0.68
58 0.69
59 0.7
60 0.69
61 0.75
62 0.82