Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L5C5

Protein Details
Accession A0A015L5C5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SQEKRQKTSKGKEKASYIKRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MSQEKRQKTSKGKEKASYIKRTRASLTGAQKQEVCLKKLQKPTPKNKELAKEYDVSQGMISDILKESEKWLALKLDSYEASLKKTSQIKFSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.8
4 0.79
5 0.75
6 0.74
7 0.7
8 0.66
9 0.6
10 0.53
11 0.49
12 0.46
13 0.48
14 0.48
15 0.45
16 0.43
17 0.41
18 0.39
19 0.42
20 0.37
21 0.31
22 0.29
23 0.32
24 0.38
25 0.46
26 0.52
27 0.54
28 0.6
29 0.69
30 0.73
31 0.73
32 0.71
33 0.66
34 0.67
35 0.61
36 0.56
37 0.48
38 0.39
39 0.36
40 0.37
41 0.33
42 0.25
43 0.21
44 0.16
45 0.14
46 0.13
47 0.11
48 0.06
49 0.06
50 0.07
51 0.08
52 0.08
53 0.1
54 0.12
55 0.13
56 0.13
57 0.15
58 0.16
59 0.16
60 0.18
61 0.18
62 0.19
63 0.18
64 0.2
65 0.23
66 0.22
67 0.25
68 0.24
69 0.23
70 0.26
71 0.33
72 0.34
73 0.37