Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015IPL3

Protein Details
Accession A0A015IPL3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-110RKGKGERKGKGRTKGKGKEQGNBasic
NLS Segment(s)
PositionSequence
6-106KGRTKGKGNEREENDRERENERERERKGKGRTKGKGENGRERGERRERGERKGKGRTKGKGGKGTTWKGENGRERGERKGKGERKGKGERKGKGRTKGKGK
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MKTTGKGRTKGKGNEREENDRERENERERERKGKGRTKGKGENGRERGERRERGERKGKGRTKGKGGKGTTWKGENGRERGERKGKGERKGKGERKGKGRTKGKGKEQGNTQTYTPPTYKLTQTCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.73
5 0.7
6 0.64
7 0.57
8 0.52
9 0.47
10 0.48
11 0.45
12 0.5
13 0.51
14 0.55
15 0.56
16 0.62
17 0.65
18 0.66
19 0.69
20 0.69
21 0.71
22 0.73
23 0.75
24 0.75
25 0.78
26 0.79
27 0.79
28 0.77
29 0.78
30 0.72
31 0.7
32 0.65
33 0.58
34 0.57
35 0.56
36 0.54
37 0.49
38 0.55
39 0.54
40 0.58
41 0.65
42 0.63
43 0.62
44 0.67
45 0.67
46 0.65
47 0.69
48 0.65
49 0.65
50 0.66
51 0.65
52 0.63
53 0.59
54 0.57
55 0.56
56 0.56
57 0.49
58 0.43
59 0.39
60 0.33
61 0.38
62 0.38
63 0.34
64 0.37
65 0.4
66 0.4
67 0.46
68 0.51
69 0.48
70 0.46
71 0.53
72 0.54
73 0.58
74 0.64
75 0.61
76 0.63
77 0.7
78 0.73
79 0.73
80 0.74
81 0.72
82 0.74
83 0.78
84 0.78
85 0.78
86 0.77
87 0.76
88 0.79
89 0.81
90 0.81
91 0.81
92 0.76
93 0.72
94 0.73
95 0.74
96 0.67
97 0.6
98 0.52
99 0.48
100 0.47
101 0.44
102 0.37
103 0.3
104 0.31
105 0.33
106 0.38