Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015K8L3

Protein Details
Accession A0A015K8L3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-53YILRATINRKLRRKKNSIEVLVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011021  Arrestin-like_N  
Pfam View protein in Pfam  
PF00339  Arrestin_N  
Amino Acid Sequences MASNRFRFTFEFEIPKGVIESFHTQFEKVQYILRATINRKLRRKKNSIEVLVPLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.27
4 0.2
5 0.17
6 0.14
7 0.18
8 0.17
9 0.2
10 0.2
11 0.19
12 0.2
13 0.22
14 0.2
15 0.15
16 0.16
17 0.13
18 0.14
19 0.16
20 0.18
21 0.2
22 0.21
23 0.28
24 0.35
25 0.43
26 0.51
27 0.6
28 0.67
29 0.72
30 0.79
31 0.8
32 0.82
33 0.83
34 0.81
35 0.75
36 0.7