Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IR32

Protein Details
Accession A0A015IR32   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-145VYKDTKRYSRVKVKNDNSSWRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences METEWKFRKEVVEQINRRMLEYDEDTDIIILDKSPYCEYYYQKTKSFDRGLITPHGNHEMEKEIFRLKETIDKSIVIFLEKDGDVCWKNYIGRETKKMEKSSYPTLKKDEYLDMVKMFEENQSVYKDTKRYSRVKVKNDNSSWRKVFKEVEKWRKVQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.57
4 0.54
5 0.47
6 0.38
7 0.33
8 0.33
9 0.29
10 0.23
11 0.23
12 0.22
13 0.21
14 0.19
15 0.14
16 0.1
17 0.07
18 0.07
19 0.08
20 0.11
21 0.12
22 0.13
23 0.15
24 0.19
25 0.22
26 0.29
27 0.37
28 0.39
29 0.43
30 0.47
31 0.48
32 0.52
33 0.52
34 0.46
35 0.4
36 0.38
37 0.36
38 0.36
39 0.35
40 0.28
41 0.26
42 0.27
43 0.24
44 0.22
45 0.2
46 0.2
47 0.19
48 0.19
49 0.18
50 0.16
51 0.16
52 0.17
53 0.16
54 0.12
55 0.17
56 0.18
57 0.2
58 0.18
59 0.19
60 0.18
61 0.19
62 0.19
63 0.13
64 0.11
65 0.08
66 0.1
67 0.09
68 0.09
69 0.07
70 0.1
71 0.1
72 0.11
73 0.11
74 0.1
75 0.11
76 0.13
77 0.18
78 0.22
79 0.25
80 0.3
81 0.34
82 0.41
83 0.47
84 0.47
85 0.46
86 0.44
87 0.46
88 0.5
89 0.55
90 0.52
91 0.49
92 0.51
93 0.5
94 0.47
95 0.44
96 0.37
97 0.31
98 0.29
99 0.28
100 0.24
101 0.22
102 0.21
103 0.18
104 0.15
105 0.12
106 0.1
107 0.09
108 0.11
109 0.13
110 0.15
111 0.17
112 0.21
113 0.24
114 0.26
115 0.33
116 0.38
117 0.43
118 0.51
119 0.6
120 0.65
121 0.71
122 0.79
123 0.79
124 0.82
125 0.82
126 0.83
127 0.78
128 0.78
129 0.73
130 0.67
131 0.62
132 0.56
133 0.57
134 0.56
135 0.61
136 0.63
137 0.69
138 0.72