Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KQ90

Protein Details
Accession A0A015KQ90    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-71GSMRAMRRKMSTKKKQKRDIEQMVTLHydrophilic
NLS Segment(s)
PositionSequence
44-63NGGSMRAMRRKMSTKKKQKR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008936  Rho_GTPase_activation_prot  
IPR000198  RhoGAP_dom  
Gene Ontology GO:0005096  F:GTPase activator activity  
GO:0007165  P:signal transduction  
PROSITE View protein in PROSITE  
PS50238  RHOGAP  
Amino Acid Sequences MFRGKPMSTTQPNYTANPNLQYLQKNNGLRRTISNGSNSLKRGNGGSMRAMRRKMSTKKKQKRDIEQMVTLGEAYLIIHLCAGEVVVRGLTEPEIFKPVRIRDGANEVRYLINCLLRDNRAEFEDELKFQDIHNIVAGIRWALRNCTTIIIPYDYYEQFVRYEQGKLNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.48
3 0.44
4 0.41
5 0.39
6 0.33
7 0.34
8 0.37
9 0.35
10 0.35
11 0.4
12 0.43
13 0.45
14 0.51
15 0.49
16 0.46
17 0.47
18 0.48
19 0.45
20 0.42
21 0.41
22 0.38
23 0.4
24 0.42
25 0.39
26 0.34
27 0.3
28 0.28
29 0.25
30 0.25
31 0.24
32 0.22
33 0.26
34 0.3
35 0.35
36 0.39
37 0.4
38 0.38
39 0.39
40 0.46
41 0.5
42 0.54
43 0.59
44 0.66
45 0.75
46 0.83
47 0.88
48 0.88
49 0.89
50 0.88
51 0.87
52 0.81
53 0.73
54 0.63
55 0.53
56 0.44
57 0.33
58 0.22
59 0.12
60 0.06
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.1
82 0.1
83 0.11
84 0.15
85 0.17
86 0.2
87 0.2
88 0.21
89 0.19
90 0.28
91 0.32
92 0.28
93 0.28
94 0.25
95 0.25
96 0.24
97 0.25
98 0.17
99 0.16
100 0.15
101 0.16
102 0.19
103 0.19
104 0.21
105 0.2
106 0.21
107 0.18
108 0.21
109 0.19
110 0.2
111 0.21
112 0.2
113 0.2
114 0.2
115 0.19
116 0.17
117 0.23
118 0.19
119 0.18
120 0.18
121 0.16
122 0.14
123 0.14
124 0.15
125 0.09
126 0.1
127 0.12
128 0.12
129 0.15
130 0.17
131 0.18
132 0.19
133 0.21
134 0.2
135 0.2
136 0.22
137 0.22
138 0.21
139 0.21
140 0.25
141 0.22
142 0.24
143 0.22
144 0.2
145 0.18
146 0.19
147 0.21
148 0.18
149 0.22