Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LAI0

Protein Details
Accession A0A015LAI0    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-24SETFSSKPVPSQKKDKTRVTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 5.5, cyto_mito 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences MSPSETFSSKPVPSQKKDKTRVTVILGVNATGTDKLKPWVIGNLKRLRPLSKVNLERLPVYYRGNPKAWMNSLVFEKVLCEMDRRFKIQDKKILLLIDNALSHFDSHYLPALEIEQNDDDNASNENQTFRGCDGRVGGSRGRSGHSGDSYHDESGGYQLDISWIQLTHVEVVFLPSNTTSHLQPLDAGIIASFKNYFKRKFCRHMLDLFEEGKDINSEKINIKEAIDYVAKSWDCVTEETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.72
4 0.8
5 0.82
6 0.8
7 0.78
8 0.77
9 0.72
10 0.7
11 0.6
12 0.57
13 0.48
14 0.4
15 0.32
16 0.26
17 0.21
18 0.14
19 0.14
20 0.1
21 0.11
22 0.13
23 0.15
24 0.17
25 0.17
26 0.25
27 0.32
28 0.38
29 0.46
30 0.53
31 0.53
32 0.57
33 0.59
34 0.53
35 0.49
36 0.5
37 0.5
38 0.51
39 0.54
40 0.54
41 0.56
42 0.54
43 0.51
44 0.46
45 0.4
46 0.33
47 0.31
48 0.31
49 0.34
50 0.37
51 0.38
52 0.37
53 0.37
54 0.4
55 0.38
56 0.36
57 0.3
58 0.28
59 0.28
60 0.26
61 0.23
62 0.17
63 0.15
64 0.13
65 0.14
66 0.11
67 0.12
68 0.13
69 0.21
70 0.24
71 0.27
72 0.28
73 0.33
74 0.42
75 0.46
76 0.52
77 0.48
78 0.47
79 0.47
80 0.45
81 0.38
82 0.31
83 0.25
84 0.18
85 0.14
86 0.12
87 0.1
88 0.09
89 0.09
90 0.07
91 0.08
92 0.06
93 0.07
94 0.09
95 0.08
96 0.08
97 0.08
98 0.09
99 0.09
100 0.08
101 0.1
102 0.09
103 0.08
104 0.08
105 0.08
106 0.07
107 0.07
108 0.08
109 0.06
110 0.06
111 0.07
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.11
118 0.11
119 0.11
120 0.12
121 0.14
122 0.16
123 0.18
124 0.18
125 0.17
126 0.19
127 0.18
128 0.19
129 0.17
130 0.17
131 0.18
132 0.18
133 0.17
134 0.16
135 0.21
136 0.21
137 0.2
138 0.18
139 0.15
140 0.13
141 0.14
142 0.14
143 0.08
144 0.06
145 0.06
146 0.07
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.08
153 0.08
154 0.09
155 0.09
156 0.09
157 0.08
158 0.11
159 0.12
160 0.11
161 0.11
162 0.09
163 0.09
164 0.11
165 0.13
166 0.11
167 0.13
168 0.14
169 0.13
170 0.13
171 0.14
172 0.13
173 0.11
174 0.11
175 0.07
176 0.08
177 0.07
178 0.08
179 0.08
180 0.09
181 0.17
182 0.23
183 0.3
184 0.37
185 0.47
186 0.55
187 0.63
188 0.71
189 0.73
190 0.71
191 0.73
192 0.71
193 0.66
194 0.61
195 0.54
196 0.44
197 0.35
198 0.3
199 0.24
200 0.19
201 0.14
202 0.13
203 0.14
204 0.17
205 0.2
206 0.24
207 0.28
208 0.27
209 0.27
210 0.27
211 0.25
212 0.26
213 0.24
214 0.21
215 0.18
216 0.24
217 0.23
218 0.22
219 0.22
220 0.21
221 0.21