Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KWP8

Protein Details
Accession A0A015KWP8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-73NRFTASRIVHRRRNQRKLRREIKYPLHydrophilic
NLS Segment(s)
PositionSequence
58-67RRRNQRKLRR
Subcellular Location(s) nucl 24, cyto_nucl 13.333, mito_nucl 12.833
Family & Domain DBs
Amino Acid Sequences MIDHKQQPTNLTQMKHTSLNGLFTDQKDNATSNYKEPSDSSSIGNRGNRFTASRIVHRRRNQRKLRREIKYPLNHYMKRLPIQITNDPFTIQLFNGSPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.38
4 0.34
5 0.29
6 0.32
7 0.28
8 0.26
9 0.25
10 0.24
11 0.28
12 0.23
13 0.23
14 0.21
15 0.21
16 0.2
17 0.24
18 0.24
19 0.21
20 0.25
21 0.24
22 0.24
23 0.23
24 0.25
25 0.23
26 0.23
27 0.22
28 0.21
29 0.23
30 0.26
31 0.28
32 0.25
33 0.22
34 0.22
35 0.21
36 0.19
37 0.18
38 0.22
39 0.21
40 0.28
41 0.36
42 0.42
43 0.5
44 0.56
45 0.65
46 0.69
47 0.77
48 0.8
49 0.81
50 0.85
51 0.87
52 0.9
53 0.85
54 0.82
55 0.8
56 0.79
57 0.78
58 0.73
59 0.72
60 0.72
61 0.67
62 0.63
63 0.62
64 0.58
65 0.52
66 0.51
67 0.45
68 0.41
69 0.46
70 0.5
71 0.49
72 0.46
73 0.43
74 0.39
75 0.36
76 0.31
77 0.27
78 0.18
79 0.17