Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015NHL0

Protein Details
Accession A0A015NHL0   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
170-195RLAFVKEYRLKQRKRDKQAIADTRTLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 11.5, nucl 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008813  Plasmid_replication_RepL  
Gene Ontology GO:0006260  P:DNA replication  
GO:0006276  P:plasmid maintenance  
Pfam View protein in Pfam  
PF05732  RepL  
Amino Acid Sequences MTEENQEKSTTAPAKKSRRGMTRYAENPFLDAALASQKTRTKRITNSTGDHLMIVSEQTGEVVGPAGFWHTEEVDQTKFIKLYVNGVKAVKELTSAGTKLLELLYLEMQRNIGKDQAHMSFAAVDQTLNPISEATFYRGMKELVEKGFLAESMSTGLYFVNPDYLWNGDRLAFVKEYRLKQRKRDKQAIADTRTLSLPFDQQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.71
4 0.72
5 0.74
6 0.75
7 0.74
8 0.73
9 0.74
10 0.72
11 0.68
12 0.64
13 0.55
14 0.5
15 0.42
16 0.33
17 0.23
18 0.17
19 0.12
20 0.13
21 0.14
22 0.13
23 0.17
24 0.21
25 0.25
26 0.32
27 0.37
28 0.38
29 0.45
30 0.54
31 0.59
32 0.61
33 0.62
34 0.6
35 0.57
36 0.51
37 0.43
38 0.33
39 0.24
40 0.18
41 0.13
42 0.08
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.06
59 0.08
60 0.1
61 0.1
62 0.11
63 0.12
64 0.12
65 0.12
66 0.12
67 0.14
68 0.12
69 0.18
70 0.22
71 0.23
72 0.24
73 0.24
74 0.24
75 0.21
76 0.22
77 0.14
78 0.1
79 0.08
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.06
89 0.04
90 0.05
91 0.07
92 0.08
93 0.08
94 0.08
95 0.09
96 0.09
97 0.1
98 0.1
99 0.11
100 0.1
101 0.11
102 0.13
103 0.14
104 0.14
105 0.14
106 0.13
107 0.11
108 0.11
109 0.11
110 0.08
111 0.06
112 0.05
113 0.07
114 0.08
115 0.07
116 0.07
117 0.06
118 0.06
119 0.08
120 0.1
121 0.11
122 0.16
123 0.16
124 0.18
125 0.2
126 0.2
127 0.19
128 0.21
129 0.21
130 0.17
131 0.19
132 0.17
133 0.16
134 0.16
135 0.15
136 0.13
137 0.09
138 0.08
139 0.07
140 0.08
141 0.07
142 0.07
143 0.07
144 0.06
145 0.07
146 0.06
147 0.08
148 0.07
149 0.08
150 0.1
151 0.12
152 0.13
153 0.13
154 0.14
155 0.12
156 0.14
157 0.14
158 0.16
159 0.16
160 0.15
161 0.23
162 0.29
163 0.35
164 0.45
165 0.54
166 0.57
167 0.65
168 0.76
169 0.79
170 0.82
171 0.86
172 0.83
173 0.84
174 0.88
175 0.88
176 0.82
177 0.77
178 0.68
179 0.6
180 0.53
181 0.43
182 0.34
183 0.26