Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015MAU2

Protein Details
Accession A0A015MAU2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
95-123PNTNKQVTPKLKSNKKKKAKGGGNTNKEIHydrophilic
NLS Segment(s)
PositionSequence
62-74NKPKVKNIPNKKS
87-116KKKDHKFSPNTNKQVTPKLKSNKKKKAKGG
Subcellular Location(s) mito 16, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MATFASVFKIIQTSKEKRKLIGYFENWKATLKALDKPQVFLTIGKELKWCQHFMPNLKKALNKPKVKNIPNKKSGNAGQQSGNVNLKKKDHKFSPNTNKQVTPKLKSNKKKKAKGGGNTNKEILAEILVLLPNLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.57
4 0.55
5 0.63
6 0.61
7 0.6
8 0.61
9 0.57
10 0.56
11 0.59
12 0.6
13 0.52
14 0.49
15 0.42
16 0.33
17 0.32
18 0.26
19 0.26
20 0.28
21 0.36
22 0.35
23 0.36
24 0.36
25 0.33
26 0.31
27 0.27
28 0.24
29 0.24
30 0.24
31 0.22
32 0.23
33 0.21
34 0.26
35 0.27
36 0.25
37 0.19
38 0.25
39 0.29
40 0.34
41 0.44
42 0.42
43 0.44
44 0.44
45 0.46
46 0.46
47 0.52
48 0.54
49 0.52
50 0.51
51 0.57
52 0.64
53 0.68
54 0.72
55 0.72
56 0.72
57 0.72
58 0.72
59 0.63
60 0.59
61 0.57
62 0.55
63 0.47
64 0.4
65 0.32
66 0.33
67 0.34
68 0.31
69 0.33
70 0.26
71 0.26
72 0.27
73 0.3
74 0.35
75 0.39
76 0.43
77 0.45
78 0.53
79 0.58
80 0.66
81 0.73
82 0.74
83 0.76
84 0.72
85 0.7
86 0.64
87 0.67
88 0.63
89 0.57
90 0.56
91 0.6
92 0.67
93 0.72
94 0.79
95 0.8
96 0.84
97 0.88
98 0.88
99 0.89
100 0.88
101 0.88
102 0.88
103 0.88
104 0.85
105 0.8
106 0.71
107 0.61
108 0.51
109 0.42
110 0.31
111 0.22
112 0.13
113 0.1
114 0.1
115 0.1