Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015M1D2

Protein Details
Accession A0A015M1D2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-74SFTPKQTDRERDKNHEKDRYBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR012296  Nuclease_put_TT1808  
IPR008538  Uma2  
Pfam View protein in Pfam  
PF05685  Uma2  
Amino Acid Sequences MPQTPYAREKVVAEIVGQLRNWNIETHQNGGVTSSQGGFDFNVGGQRTIRAPDVSFTPKQTDRERDKNHEKDRYDIGKTFFINERRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.24
5 0.2
6 0.17
7 0.18
8 0.18
9 0.13
10 0.13
11 0.18
12 0.2
13 0.23
14 0.24
15 0.23
16 0.22
17 0.22
18 0.21
19 0.15
20 0.13
21 0.1
22 0.08
23 0.07
24 0.08
25 0.07
26 0.06
27 0.06
28 0.05
29 0.09
30 0.08
31 0.09
32 0.08
33 0.09
34 0.1
35 0.11
36 0.12
37 0.09
38 0.09
39 0.1
40 0.15
41 0.19
42 0.19
43 0.2
44 0.24
45 0.27
46 0.32
47 0.37
48 0.42
49 0.46
50 0.55
51 0.61
52 0.65
53 0.72
54 0.77
55 0.8
56 0.8
57 0.73
58 0.67
59 0.69
60 0.66
61 0.6
62 0.54
63 0.49
64 0.46
65 0.45
66 0.44
67 0.42
68 0.44