Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JVI0

Protein Details
Accession A0A0D8JVI0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
36-63GPGWMTVRKVQKKKRIKKRQESLDQGSDHydrophilic
NLS Segment(s)
PositionSequence
43-54RKVQKKKRIKKR
Subcellular Location(s) mito 15, mito_nucl 13.833, nucl 10.5, cyto_nucl 6.666
Family & Domain DBs
KEGG cim:CIMG_12275  -  
Amino Acid Sequences MRKMMVVLRRFNRSSKRRDVWKVAYSRMNQRWGIPGPGWMTVRKVQKKKRIKKRQESLDQGSDREQYQAGKARFGGQSVGRVLQRTSSSIATKSDGLRAKKKNGMDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.66
3 0.69
4 0.71
5 0.77
6 0.8
7 0.77
8 0.77
9 0.73
10 0.68
11 0.66
12 0.6
13 0.62
14 0.58
15 0.56
16 0.48
17 0.45
18 0.45
19 0.4
20 0.39
21 0.3
22 0.28
23 0.23
24 0.26
25 0.26
26 0.2
27 0.21
28 0.24
29 0.33
30 0.38
31 0.45
32 0.5
33 0.59
34 0.69
35 0.76
36 0.82
37 0.85
38 0.87
39 0.89
40 0.9
41 0.9
42 0.89
43 0.86
44 0.8
45 0.77
46 0.67
47 0.57
48 0.49
49 0.4
50 0.31
51 0.24
52 0.19
53 0.12
54 0.14
55 0.22
56 0.2
57 0.2
58 0.2
59 0.24
60 0.24
61 0.24
62 0.23
63 0.16
64 0.2
65 0.2
66 0.23
67 0.2
68 0.2
69 0.2
70 0.21
71 0.21
72 0.19
73 0.21
74 0.21
75 0.23
76 0.24
77 0.25
78 0.24
79 0.25
80 0.24
81 0.29
82 0.32
83 0.36
84 0.44
85 0.49
86 0.54
87 0.58