Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015L0X9

Protein Details
Accession A0A015L0X9    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-40RDNNNKRKNDNDVKNTKKTKKGISDNNNIKKNKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MISSTSARDNNNKRKNDNDVKNTKKTKKGISDNNNIKKNKKDNAKLAETVTDKLNTNVFNVSFALWSILKETNIKTFTMNVETGLMQYTKSDGILHVRSVSDLRIVEAKVNEISIPYNFSRIGSERRKARDLRIRVEYFDKSVKLLNTTAELPKTYIGFFNDEFSIFKSALAVELHKNEKTPSGTPTSIVTNNDFGDRQASVEAILNISADLSIWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.76
4 0.76
5 0.75
6 0.77
7 0.78
8 0.83
9 0.87
10 0.84
11 0.82
12 0.79
13 0.78
14 0.77
15 0.79
16 0.8
17 0.8
18 0.83
19 0.84
20 0.87
21 0.86
22 0.78
23 0.72
24 0.71
25 0.69
26 0.67
27 0.67
28 0.66
29 0.67
30 0.72
31 0.74
32 0.67
33 0.6
34 0.58
35 0.5
36 0.42
37 0.35
38 0.29
39 0.24
40 0.22
41 0.23
42 0.18
43 0.17
44 0.18
45 0.16
46 0.15
47 0.14
48 0.14
49 0.11
50 0.1
51 0.11
52 0.09
53 0.09
54 0.11
55 0.12
56 0.12
57 0.14
58 0.15
59 0.19
60 0.21
61 0.21
62 0.19
63 0.19
64 0.19
65 0.21
66 0.19
67 0.14
68 0.14
69 0.13
70 0.13
71 0.12
72 0.1
73 0.07
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.11
81 0.12
82 0.12
83 0.12
84 0.12
85 0.12
86 0.12
87 0.12
88 0.1
89 0.08
90 0.09
91 0.1
92 0.1
93 0.11
94 0.11
95 0.11
96 0.09
97 0.09
98 0.09
99 0.07
100 0.08
101 0.06
102 0.09
103 0.08
104 0.1
105 0.1
106 0.1
107 0.12
108 0.14
109 0.22
110 0.24
111 0.3
112 0.35
113 0.39
114 0.45
115 0.45
116 0.51
117 0.52
118 0.52
119 0.52
120 0.55
121 0.52
122 0.48
123 0.51
124 0.43
125 0.36
126 0.34
127 0.28
128 0.2
129 0.22
130 0.21
131 0.19
132 0.18
133 0.16
134 0.15
135 0.17
136 0.19
137 0.17
138 0.17
139 0.15
140 0.15
141 0.15
142 0.14
143 0.14
144 0.13
145 0.16
146 0.15
147 0.17
148 0.17
149 0.16
150 0.16
151 0.16
152 0.17
153 0.13
154 0.13
155 0.11
156 0.1
157 0.12
158 0.13
159 0.13
160 0.14
161 0.19
162 0.23
163 0.23
164 0.24
165 0.23
166 0.27
167 0.29
168 0.28
169 0.27
170 0.3
171 0.3
172 0.3
173 0.32
174 0.32
175 0.31
176 0.31
177 0.3
178 0.26
179 0.26
180 0.27
181 0.25
182 0.21
183 0.2
184 0.18
185 0.16
186 0.13
187 0.13
188 0.11
189 0.14
190 0.14
191 0.12
192 0.12
193 0.11
194 0.1
195 0.1
196 0.09