Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KPC5

Protein Details
Accession A0A015KPC5   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-61SSSSYRILQRRRNQRKLRHRRRITTNTYALHydrophilic
NLS Segment(s)
PositionSequence
41-53RRRNQRKLRHRRR
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEHITSTSCTTSCCEESFMDNKPASFPMIINSSSSYRILQRRRNQRKLRHRRRITTNTYALNQLPVQITNDPIMIKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.25
4 0.26
5 0.28
6 0.28
7 0.27
8 0.26
9 0.25
10 0.24
11 0.21
12 0.19
13 0.15
14 0.12
15 0.14
16 0.14
17 0.13
18 0.14
19 0.14
20 0.15
21 0.16
22 0.14
23 0.16
24 0.23
25 0.29
26 0.36
27 0.43
28 0.53
29 0.63
30 0.73
31 0.78
32 0.81
33 0.86
34 0.89
35 0.92
36 0.92
37 0.9
38 0.89
39 0.9
40 0.89
41 0.86
42 0.83
43 0.78
44 0.71
45 0.64
46 0.58
47 0.47
48 0.41
49 0.32
50 0.26
51 0.21
52 0.18
53 0.19
54 0.17
55 0.19
56 0.17
57 0.18