Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JHM2

Protein Details
Accession A0A015JHM2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-68HSNILCAYHKQKKKKKNFEKIDTKSLKKHydrophilic
NLS Segment(s)
PositionSequence
51-57QKKKKKN
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 4, cyto 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
Amino Acid Sequences MSSKFWAELSSDYEKLFETETGYDVIIYAGEEQNIKEIHAHSNILCAYHKQKKKKKNFEKIDTKSLKKLSSFQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.15
5 0.11
6 0.11
7 0.12
8 0.12
9 0.12
10 0.11
11 0.09
12 0.09
13 0.06
14 0.06
15 0.06
16 0.05
17 0.06
18 0.06
19 0.06
20 0.09
21 0.09
22 0.09
23 0.09
24 0.09
25 0.12
26 0.13
27 0.14
28 0.11
29 0.14
30 0.14
31 0.14
32 0.13
33 0.14
34 0.2
35 0.28
36 0.35
37 0.43
38 0.52
39 0.61
40 0.72
41 0.81
42 0.85
43 0.87
44 0.91
45 0.91
46 0.93
47 0.9
48 0.89
49 0.86
50 0.79
51 0.76
52 0.7
53 0.64
54 0.55