Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IP25

Protein Details
Accession A0A015IP25   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MTAPNQKRRRKKNKTKEKKKERVKSTKPKQPPEKANRLLTBasic
NLS Segment(s)
PositionSequence
7-34KRRRKKNKTKEKKKERVKSTKPKQPPEK
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MTAPNQKRRRKKNKTKEKKKERVKSTKPKQPPEKANRLLTLPPTHYSKVYLLAYAPLRPPDLPPKTHVDSKALASQLPKANVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.97
3 0.97
4 0.97
5 0.96
6 0.96
7 0.95
8 0.94
9 0.94
10 0.93
11 0.93
12 0.91
13 0.91
14 0.89
15 0.89
16 0.88
17 0.86
18 0.86
19 0.84
20 0.84
21 0.8
22 0.75
23 0.66
24 0.58
25 0.5
26 0.43
27 0.36
28 0.28
29 0.24
30 0.24
31 0.23
32 0.21
33 0.21
34 0.19
35 0.2
36 0.19
37 0.17
38 0.14
39 0.17
40 0.17
41 0.17
42 0.18
43 0.14
44 0.15
45 0.15
46 0.18
47 0.25
48 0.29
49 0.29
50 0.31
51 0.37
52 0.41
53 0.46
54 0.45
55 0.39
56 0.37
57 0.38
58 0.4
59 0.34
60 0.3
61 0.26
62 0.32
63 0.34
64 0.34