Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015I323

Protein Details
Accession A0A015I323   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-46VKNYWNSKHRTNNRNKNKSYERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 14.333, cyto_nucl 10.666, mito 7
Family & Domain DBs
Amino Acid Sequences MKKWAELAKALSNNRKDGRRTELQVKNYWNSKHRTNNRNKNKSYERISDQMRLKKILN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.5
4 0.47
5 0.49
6 0.49
7 0.5
8 0.54
9 0.55
10 0.54
11 0.56
12 0.55
13 0.51
14 0.49
15 0.47
16 0.42
17 0.39
18 0.42
19 0.47
20 0.53
21 0.59
22 0.65
23 0.73
24 0.8
25 0.86
26 0.81
27 0.8
28 0.79
29 0.78
30 0.74
31 0.7
32 0.65
33 0.62
34 0.64
35 0.62
36 0.62
37 0.62
38 0.58